KEGG   Paenibacillus xylanexedens: BS614_13530Help
Entry
BS614_13530       CDS       T04676                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00020  Citrate cycle (TCA cycle)
pxl00480  Glutathione metabolism
pxl01100  Metabolic pathways
pxl01110  Biosynthesis of secondary metabolites
pxl01120  Microbial metabolism in diverse environments
pxl01130  Biosynthesis of antibiotics
pxl01200  Carbon metabolism
pxl01210  2-Oxocarboxylic acid metabolism
pxl01230  Biosynthesis of amino acids
Module
pxl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pxl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BS614_13530
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BS614_13530
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BS614_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APO44929
UniProt: A0A1L5LNE2
LinkDB All DBs
Position
3016477..3017769
Genome map
AA seq 430 aa AA seqDB search
MKLEKFAHPTEGEKIQIDNGTLQVPSNPIIPFIEGDGTGRDIWKASKRVLDAAVEKAYDG
NKKIAWYEVFAGQKAFDTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQE
LDLYTCLRPVRYFDGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEEVKKVIQFLQQ
EMGANKIRFPETSGIGIKPVSSEGSKRLVRAAVQYAIDHNRKTVTLVHKGNIMKFTEGAF
KNWGYEVAEEEFADKVFTWAQYDIIKENEGTDAANAAQKAAEDAGKIIVKDAIADIALQQ
VLTRPGEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYA
DKDVVNPGSVILSGVMLLEHLGWQEAANLIYKGMETSINNKTVTYDFARLMDGATEVKCS
EFADQIIKNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagaaaaatttgctcacccaactgaaggcgaaaaaatccaaattgataacggt
acacttcaagtacctagtaatccaatcattccatttatcgaaggtgacggtacaggccgt
gatatctggaaagcttccaaacgtgtattggatgcagctgttgaaaaagcttatgatggc
aacaaaaaaatcgcatggtatgaagtgtttgctggacaaaaagcattcgatacatacggt
gagtggttgccgaatgatacactggaagccattcgtgagtatatcgtagcgatcaaagga
ccattgactacaccaatcggtggcggtattcgttccctgaacgtagccctgcgtcaagag
cttgacctgtacacatgcttgcgtcctgttcgttatttcgacggtgtaccttctccggtt
aaacgtcctgagttggtagacatggtcattttccgtgagaatacggaagatatctatgca
ggaatcgagtatgctgaaggttctgaagaagtgaaaaaagtgatccagttcctgcaacag
gagatgggtgctaacaaaatccgtttccctgagacttccggtattggtatcaaaccagtt
tcttccgaaggttcgaaacgtttggtacgtgcagcagttcagtacgcaattgaccataac
cgtaagacggttacattggtacacaaaggtaatatcatgaaattcacagaaggtgccttc
aaaaactggggatatgaagtggctgaagaagagttcgctgacaaagtattcacatgggca
caatacgacatcatcaaagaaaacgaaggtacagatgcagcgaatgcagcacaaaaagct
gctgaagatgctggtaaaatcatcgtaaaagatgcgattgccgatatcgctctgcaacaa
gtattgactcgtccaggcgaatttgatgttatcgcaacattgaacctgaacggtgactat
ctgtccgatgcacttgcagcgcaagttggcggaattggtatcgctcctggagcgaacatc
aactacgtaacaggacatgctatcttcgaagcaactcacggtactgcacctaaatacgcg
gacaaagatgtcgtgaacccaggttccgttattctgtccggagtaatgttgcttgagcac
ttgggatggcaagaagcagctaacctgatctacaaaggtatggaaacatccattaacaat
aaaacagtaacgtatgactttgcacgtctgatggacggcgctactgaagtgaaatgttct
gaattcgcggatcaaatcattaaaaacctgtaa

DBGET integrated database retrieval system