KEGG   Paenibacillus xylanexedens: BS614_19570Help
Entry
BS614_19570       CDS       T04676                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pxl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BS614_19570
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BS614_19570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APO46011
UniProt: A0A1L5LRJ1
LinkDB All DBs
Position
4420407..4421873
Genome map
AA seq 488 aa AA seqDB search
MTTFQVEQTYSNYINGEWVKATSGETEPSINPANRKEVVGYVPTSGVEDLNRAVAAAKEA
AKDWRRLSGAERGNYLFQAANVLERRADEVAEAMTREMGKTLPEAKGETLRGVAILRYYA
GEGMRKTGDVIPSTDSEALMFTTRVPLGVVGVIAPWNFPVAIPIWKTAPALIYGNTVVLK
PAQETAVTAAKVMECFEEAGIPAGVLNLVCGRGSVIGSALAEHPDVGGITFTGSNEVGKR
VGGAALARGAKYQLEMGGKNPIIIAADADLDLAVEATISGGLKSTGQKCTATSKVIIERK
VYDAFKEKLLSQIQEIRLGDGMSSGSWMGPCASEGQLNTVLSYIQKGQDEGAVLLTGGKR
GDGPGLEEGFYVQPTVFEGVESHMSIAREEIFGPVLALIAVDSLKEAIEAANDSDYGLSA
SIYTQNVGAMLSFIRDMDAGLVRINAETAGVELQAPFGGMKMSSSHSREQGQAAIEFFTA
IKTVFVKS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatttcaggtagagcagacatacagcaattacattaacggagaatgggtgaag
gcgacatccggtgaaaccgaaccgagcatcaacccggcgaatcggaaggaggtagttggc
tacgtacccacctccggcgtagaggatctgaaccgggctgtcgcagcggcgaaggaagca
gcaaaagattggcggaggttatcgggtgcggaacgcggcaattatctatttcaggcagcc
aatgtgctggaacgccgggccgatgaagttgcagaggcgatgaccagggaaatgggcaaa
acactcccagaagccaaaggagagacactgcgcggtgtcgcgatcttaaggtattacgcc
ggagaaggcatgcgaaaaaccggtgatgtcattccatcaacggacagcgaagcactgatg
tttacgacccgcgtaccccttggcgttgtaggggttattgctccttggaatttcccggta
gccattccgatttggaaaacggctccggccttgatctacggtaatacggttgtgttgaag
cctgctcaggaaactgcggtcactgcggctaaagtaatggaatgttttgaagaggcgggc
attccggcaggcgttcttaatctggtatgcggcagaggttcagtgatcggatctgcactt
gctgagcatccggatgtgggcggaataacgttcacaggctccaatgaagtcggcaaacgg
gtcggcggcgcagcactggcacgtggggctaagtatcaacttgaaatgggtgggaaaaac
ccgattattatcgcggctgacgctgacctggatttggctgtggaagccacgatcagcggt
gggttgaaatcgaccgggcaaaaatgtacggccaccagcaaggtcattattgaacgaaaa
gtatacgatgccttcaaagaaaagctgctctcgcaaatccaggaaattcggctgggtgac
ggcatgtcttctggaagctggatgggtccatgtgcaagcgaaggacagctcaataccgtg
ctgagttatattcaaaaaggccaagatgaaggtgccgttctgctcactggcggaaaaaga
ggggacggtccgggactagaagagggattctatgtgcagccgaccgtatttgaaggggtc
gaatcccatatgtccatcgcccgggaagaaatctttggcccggttctggccttgattgcg
gtagattccctgaaggaagcgatcgaagcggctaatgatagcgattatggcttgagtgct
tccatctatacgcagaacgtcggagccatgttgtctttcatccgggacatggatgcagga
ctggtcagaattaatgcagaaacagccggcgtagagctgcaggctccgtttggcggaatg
aagatgtcaagttcacactccagagaacaggggcaagcggctatcgagtttttcacggcc
atcaaaacggtctttgtgaagtcataa

DBGET integrated database retrieval system