KEGG   Paenibacillus xylanexedens: BS614_23655Help
Entry
BS614_23655       CDS       T04676                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pxl  Paenibacillus xylanexedens
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxl01001]
    BS614_23655
Enzymes [BR:pxl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BS614_23655
Protein kinases [BR:pxl01001]
 Serine/threonine kinases: Other
  Bacterial family
   BS614_23655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Haspin_kinase GAPT FTA2 TcfC Seadorna_VP7 YrbL-PhoP_reg PIP49_C Fructosamin_kin Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: APO46739
UniProt: A0A1L5LTL4
LinkDB All DBs
Position
complement(5422133..5424343)
Genome map
AA seq 736 aa AA seqDB search
MIGHQLGGRYEVIERVGGGGMALVYKAQDLLLNRNVAIKVLRQQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDDVHYIVMEYVEGKNLNEIIKERAPLQVDESVRIASQIADA
LDHAHHNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGIVTGEKSDLYSLGIVLYQMLTGQLPFLGESPISVALKHLQEEFDEPRKFNPLIPQSV
ENVILKSMRKNPQERYQSAKEMQTDLETCLMPERRNETKIDFPDEDDIDQTRVMPAIKPE
PRGVTSTGAVPVMESNEETGKGKAKSKSWKKPALLISLTVLILIAMVGVVWYVKGMLVVP
EVTVPNVITQTEEKAREMLEEKGLVVSDEVIRLYQEGVEPGIVYEQSRKEGDVVKEGSEV
QISVGAEKELLKMIDVKQVTYDEAVKKLTALGIKEDQIQRKEEFSNDVASGSVISQTPGV
NEEFDPAIVQIELTVSKGTETVKMPDLKNLTRSEAEEKLKSAGLVLAQVQEESSYTVDQG
KVTQQWPVEAGTEVSPGDKITIFISTGYPPEALEYPFNINVSPKEEGKNSKIRITYEDAR
GKNQEWGTRTVNSTQTLTIPLVLAPNENGAVSVYRDGQFLDTYLVSYSEAKNGTVNVPSI
DPEQTTETPPENEPDPGEGSVDEGSVDPNQEGEPESTPADGEGDSVDEDTSAMNNGKGHG
KEKEKKKEVVNASSRP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgattgggcaccagctaggcggacgctatgaagtgattgagcgtgtcggcggtggcggc
atggctcttgtgtacaaagcccaggatcttctgttgaaccggaatgtagcgatcaaagtc
cttagacaacagtttgtgcatgacgaagagtttattcgccgtttccgcagggaagcacag
tcggcagcatcgctgtctcatccgaatgtagttagcatttatgacgtggggcaggaagat
gacgttcattatattgtcatggagtacgtggaaggcaaaaacttgaatgaaattattaaa
gaacgcgcccctctgcaggtggacgaatcggtgcgaatcgcttcccagattgcagatgct
cttgatcatgcacatcataatcaaatcattcatcgggatatcaaaccccacaatatatta
attggccggaatggccgtgtgaaagtaacggatttcgggattgcccgtgcggttacatct
acaacgattacgcagacgggttccgtagttggttctgtacattatttctcaccggagcat
gccaaaggcatcgttactggtgaaaaatcggacttatattctcttgggatcgtactttac
caaatgcttaccgggcaacttccgtttctgggtgaaagtccaatcagtgtggcattgaag
catttgcaggaagagttcgatgaaccacgcaaattcaatccattgattccgcaaagtgtg
gaaaatgtcatcttaaaatccatgcgtaaaaatccgcaggaacgttatcagtcggccaaa
gaaatgcagaccgatctggaaacttgcctgatgccggagagacgtaatgaaacgaagatt
gattttccggatgaggatgatatagaccagactcgcgtaatgccagcgatcaagcctgaa
ccgcgtggagttacatccacgggtgcggtgccagtgatggagtctaacgaagaaactggc
aagggtaaggcaaaatccaagagctggaagaagccagcactactcatttcattaaccgtt
cttattctaatcgccatggtgggcgttgtatggtatgtcaagggtatgctggttgtacct
gaagtaaccgtgcctaacgtgatcacccagacagaagaaaaagctcgggaaatgcttgag
gagaaaggactcgtcgtcagtgatgaggtcatccgtctgtaccaggaaggtgtcgaaccc
ggtatcgtctatgaacagagcagaaaagaaggcgatgttgtcaaagaaggatccgaggtc
cagatcagtgttggtgcagaaaaagaacttttgaagatgattgatgtcaaacaagtaact
tatgatgaggctgtcaagaagctgactgcgcttggtattaaggaagatcagattcagcgg
aaagaagagttctccaatgatgtggcttcaggttctgttatttcccagacaccgggtgtg
aatgaggaatttgatcctgctatagttcagattgagttgaccgtaagcaaaggtactgaa
acggtcaaaatgcctgatctgaaaaatcttacccgcagtgaagccgaagaaaaactgaaa
tctgctggacttgtgcttgctcaggtacaggaagaatcaagttatacggtggaccagggc
aaagtgacgcagcaatggcctgtggaagcgggcacagaggtgagtcctggtgataagatt
acaatctttatcagtacagggtatccgcccgaagcgctggaatatccttttaatatcaat
gtttcacccaaagaagagggcaaaaacagtaaaatccgtatcacgtatgaagacgcacgt
ggcaagaatcaggaatggggaacccgcactgtgaactcaacccaaaccttgaccattcca
cttgtgctagctccaaatgaaaatggggctgtgtctgtatatcgtgatgggcagttcctg
gatacgtatcttgtctcctacagtgaagccaaaaacggaacagtgaatgtaccttccatt
gacccggaacaaaccacggagacgccgccagaaaatgagcctgatccaggtgaaggtagc
gttgatgagggaagtgttgatcccaatcaggaaggtgaacctgagtccacaccggcagac
ggtgagggtgacagcgtagatgaggacacttctgccatgaataatggtaaggggcacggc
aaggaaaaagagaagaaaaaggaagtcgttaacgcatcaagccgtccataa

DBGET integrated database retrieval system