KEGG   Paenibacillus xylanexedens: BS614_27155Help
Entry
BS614_27155       CDS       T04676                                 

Definition
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BS614_27155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pxl03400]
    BS614_27155
Enzymes [BR:pxl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BS614_27155
DNA repair and recombination proteins [BR:pxl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BS614_27155
    RecFOR pathway proteins
     BS614_27155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 Mg_chelatase TIP49 Sigma54_activat AAA_22 AAA_16 AAA_14 AAA_3 TsaE NTPase_1 AAA_18 NB-ARC RNA_helicase Rad17 Resolvase AAA_33 AAA_24 AAA_2 Bac_DnaA DUF815 Sigma54_activ_2 NACHT IstB_IS21 ABC_tran AAA_17 AAA_25 AAA_28 RsgA_GTPase ATPase_2
Motif
Other DBs
NCBI-ProteinID: APO47369
UniProt: A0A1L5LVE7
LinkDB All DBs
Position
complement(6247667..6248677)
Genome map
AA seq 336 aa AA seqDB search
MDDRIISANLMMEDQNVELSLRPRYLNEYIGQNQVKENLKIYIEAAKFRNEALDHVLLYG
PPGLGKTTLANIIANELGVNLRTTSGPAIERPGDLAALLTNLQEGDVLFIDEIHRLHRTV
EEVMYPAMEDSALDIMIGKGPSARSVRLDLPPFTLIGATTRAGLLSAPLRDRFGVISRLE
FYTVDELAYIVSRSTEILGVEIVGDAAEEIALRSRGTPRIANRLLKRVRDFAQVRGDGII
TQTLAEEALQRLQIDPRGLDDIDHKMLKSMINSFRGGPVGLDTIAATIGEESQTIEDVYE
PYLLQIGMIQRTPRGRIVTDLAYHHLGLPVPPRDGK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcggattatttccgcgaacctgatgatggaggaccaaaatgttgagttgagt
cttcgtccccggtatctgaatgaatatatcgggcagaatcaggtgaaggaaaatttaaag
atatatattgaagctgctaaatttcgtaatgaggcattggatcacgttttgttatatgga
ccacctggacttggtaaaacaacacttgccaatattattgccaacgaattgggcgttaat
ttacgaactacgtcaggcccggccattgaacgcccgggtgatcttgcagcattgttaacc
aatctgcaggaaggcgatgtcttgtttattgatgagattcatcgtttgcatcgtacggtt
gaagaagtcatgtaccccgctatggaagattcggcattggatattatgattggtaaaggt
ccaagtgcacgttccgttcggctggatctgccaccattcactctgattggggctacaacg
cgtgctggcttgctgtctgctccacttcgagatcgatttggtgttatcagtcgattggaa
ttctacacggttgatgagctggcttacatcgtctcacgatccacagaaattttgggtgtg
gagattgtgggagatgctgctgaagagattgcattacgctcacgtgggacaccaaggatc
gccaaccgtttgttaaaacgagtacgcgactttgcacaggtacgtggtgatgggattata
acgcagacactggcggaagaagcgctgcaacgtctccagatcgatccacgtggcttggat
gacattgaccataagatgctcaaatcgatgatcaacagcttccggggaggtcccgtagga
ttggataccattgctgctacaatcggtgaagaaagtcagacgatcgaggatgtttatgaa
ccgtatctgcttcagattggtatgattcagcgtacaccaaggggcaggatcgtaacagat
ctcgcctatcatcatttgggtcttcctgttccaccaagagatgggaaataa

DBGET integrated database retrieval system