KEGG   Paenibacillus xylanexedens: BS614_29975Help
Entry
BS614_29975       CDS       T04676                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00620  Pyruvate metabolism
pxl00680  Methane metabolism
pxl01100  Metabolic pathways
pxl01120  Microbial metabolism in diverse environments
pxl01200  Carbon metabolism
Module
pxl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BS614_29975
  09102 Energy metabolism
   00680 Methane metabolism
    BS614_29975
Enzymes [BR:pxl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BS614_29975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APO47834
UniProt: A0A1L5LWS1
LinkDB All DBs
Position
complement(6896614..6899406)
Genome map
AA seq 930 aa AA seqDB search
MTETMVTASKSQSNNLLRRDVRFLGNILGEVLVHQGGTELLDIVEKIRETSKSLRAEFLP
ELYAEFKTMIQELDSDNRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGDAVQPGSI
EKAVQDLKERGLSHTEVEEILDDLSLELVMTAHPTEAMRRVILDIHKRISEDVMSLDNPT
LTLREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLNKFYPDHDWHVPTYLRFGSWIGGDRDGNPSVTSDVTWQTLLMQRKLALREYQRIMIE
LMGHLSFSTNIIHVSDELVQSIEQDRNSVTLKKVDIWRNEKEPYRIKLAYMIAKLNNVLD
ENKLGQPDRYHSAQDLIDELMIIDRSLRHHFADYVADTTIRKMIRQVELFGFHTAALDVR
QHSKEHENAMSEILAKMNIVEDYARLTEDGKIDLLARLLDDPRPLTSPYHQYTEGTKECL
DVFRTIKRAQNEFGDGCITSYLISMTQGASDLLEVMVFAKEVGLFTKGHNGDVVSTLQAV
PLFETIDDLHAASDIMQKLFNLPVYRASVKGRNELHEIMLGYSDSNKDGGVVTANWELRV
AMNAITAVGNEHGVKLKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVISS
RYSLQGIAYRSLEQATSALITAALNGLEPQESASERHWDSIIKEISEVSLTKYQDLIFRD
PDFFTFFKESTPLPEVGELNIGSRPSKRKNSDKFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSYYQDKEENLVVLKEMYASFPFFRTLIDTVQMAVAKADLVIAKEYSAMTSNKEARD
RIYGQIEAEFKLTKELILKITGEAEILDDVPVIQESIRLRNPYVDPLSYMQVQLLSELRD
MRERGEDDTELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactatggtaaccgccagcaaaagccaatccaacaacctgcttcggcgagac
gtgcggttcctgggcaatatactcggagaagttcttgtccatcaaggcggcacggagctt
ctagatatcgttgagaagattcgggaaacgagcaaatcgttgcgtgcagaatttctgcca
gaactctatgcagagttcaaaacgatgatccaggaattagactcggacaatcgtcaccag
gttattcgggctttcgctatttattttcaattagttaatattgctgaacaaaaccatcgg
atccggcgtaaacgggattatgaacgttctgctggggacgctgtgcagccaggatcgatt
gagaaagcagtacaggatcttaaggaacgtggactgtctcatacagaggtggaagagatt
ctcgacgatttgtcgttggaactcgttatgacagctcacccaaccgaagctatgcgccgg
gttattctggacatccataaacggatatccgaagatgtcatgtcacttgataatcctacg
ctgacgttgcgtgaacgtgaacagttgcgtgagaagctgctgaatgaggttattacactc
tggcagacagatgaacttcgcgaccgcaaaccgactgtacttgatgaagtgcggaacggg
atgtattactttcatgaaacgttgttccacgtacttccggatgtatatcaggagctggaa
cgctgcctgaacaaattttatcctgaccatgactggcatgtgccgacgtatttgcggttc
ggttcctggatcggtggagaccgggatggaaatccttcggtaacttcagatgtaacatgg
cagacgctgttgatgcaacgcaagctcgctttgcgtgaataccaacggattatgattgaa
cttatgggccatctcagcttcagcacaaacatcattcatgtatcggatgagctggtgcag
tcgattgagcaggaccgtaattctgttacattgaaaaaagtggatatctggcggaatgaa
aaagagccataccgcatcaaattggcttatatgattgccaagctgaacaatgtactggat
gaaaacaaattaggtcagcctgaccgttatcatagtgcacaggatttgattgatgaactg
atgattattgatcgaagtctgcgccatcattttgccgattacgtagcagatacgaccatt
cgcaaaatgattcgtcaagtcgagttgtttggtttccataccgcagcattggatgtgcgt
cagcacagtaaggaacatgaaaatgcgatgtcggagattttggcgaaaatgaacattgta
gaggattatgcgcgactgactgaagacggtaaaatcgatctgcttgctcgtttgctggat
gatccacgtccgcttacttctccttatcaccaatacacggagggaaccaaagagtgtctg
gatgtcttccgtaccatcaaacgtgcccagaacgaatttggggacggctgtatcacaagt
tacctgatcagtatgacgcagggcgcaagtgatttgctggaggttatggtatttgccaag
gaagtgggcttattcaccaaaggacacaacggagacgttgtatctacacttcaagcggta
ccactgtttgaaacgattgatgatctacatgcggcttcggacattatgcagaagctgttc
aaccttcctgtataccgcgcaagcgtaaaaggacggaatgaactgcatgaaatcatgctt
ggttattcagacagtaacaaggatggcggggtggttactgccaactgggaactgcgcgta
gcgatgaatgccatcacggctgtaggtaatgaacacggcgttaagttgaagttcttccat
ggacgtggcggggctcttggacgtggcgggatgccacttaaccgcagtattcttgctcaa
ccaccacatacgattggtggtggcatcaagattacggagcagggagaggttatttcttcc
cgttattccctccaggggattgcataccgcagtctggagcaggcaacttcggctctaatc
acagcagcactcaatgggcttgagccgcaagagtcagcatccgaacgtcattgggacagc
atcatcaaagagatttcggaagtatctctgacgaaatatcaggatctgattttccgtgat
ccagacttcttcaccttctttaaagaatcaacgccgcttccggaggttggtgagctgaac
attggttcccgtccatccaagcgtaaaaatagtgataagtttgaagatctgagagcgatc
ccttgggtattcgcctggacccaaagtcgttatctgcttccggcatggtatgcggcagga
acaggattgcaaagttactatcaggataaagaggaaaatctggttgtcctgaaagaaatg
tatgcaagcttcccattcttccgtacattaattgatacggtacagatggccgtagccaag
gcagatctggtcattgccaaagaatattcagccatgacttcgaacaaggaagcccgtgat
cgcatctacggtcagatcgaagccgaattcaagctcacaaaagagctgattctgaaaatt
accggagaagctgaaattctggatgatgtaccggttattcaagagtccattcgccttcgt
aacccttatgtagatccgttgtcctacatgcaagttcaacttctgagcgagctcagagat
atgcgtgaacgtggtgaggatgatacggaactgctcagagaagtgttgctgacaatcaat
ggcatcgctgcaggactgcgtaacacaggttga

DBGET integrated database retrieval system