KEGG   Paenibacillus xylanexedens: BS614_30285Help
Entry
BS614_30285       CDS       T04676                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pxl  Paenibacillus xylanexedens
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pxl03012]
    BS614_30285
   03029 Mitochondrial biogenesis [BR:pxl03029]
    BS614_30285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxl04147]
    BS614_30285
Translation factors [BR:pxl03012]
 Eukaryotic Type
  Elongation factors
   BS614_30285
 Prokaryotic Type
   BS614_30285
Mitochondrial biogenesis [BR:pxl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BS614_30285
Exosome [BR:pxl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BS614_30285
  Exosomal proteins of breast cancer cells
   BS614_30285
  Exosomal proteins of colorectal cancer cells
   BS614_30285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APO47877
UniProt: A0A1L5LWW8
LinkDB All DBs
Position
complement(6933538..6934728)
Genome map
AA seq 396 aa AA seqDB search
MAKAKYERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKTYGGAAIAFDQIDKAPEERERG
ITISTSHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLNEYEFPGDDTPITRGSAREALA
NPDGEWAQKIVEMFKEIDTYIPLPERQTDKPFLMPVEDVFSITGRGTVATGRVERGTVKV
GEEIEIVGITEETKKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRTQIERGQVLAKPGS
VKPHTEFTAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIINLPEGTEMVMPGDNIT
VTVSLISPIAIEEGTKFSIREGGRTVGAGSVASIQK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatacgaacgtaataaaccccacgttaacatcggtactattggtcac
gtcgatcacggtaaaacaactctgactgctgcaatcacaactgtattgtccaaaacttac
ggtggtgctgcaattgcattcgaccaaatcgacaaagctccagaagagcgcgaacgcggt
atcacaatctccacatcacacgttgagtacgaaactgacactcgtcactacgctcacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcactggcgcggctcaaatggat
ggagctatcttggtagtatccgcagcagacggcccaatgccacaaactcgtgagcatatc
ttgctctcccgtcaagtaggcgtaccttacattgttgtattcttgaacaaatgtgacatg
gttgaagacgaagagttgttggaattggttgagatggaagttcgcgaccttcttaacgaa
tatgagttcccaggtgacgatactccaatcactcgtggatccgctcgtgaagctctggca
aacccagatggcgaatgggctcaaaaaatcgttgagatgttcaaagagatcgacacttac
atcccactgcctgagcgtcaaactgacaagcctttcttgatgcctgtcgaggacgtattc
tccatcactggtcgtggtactgttgctactggccgtgtagagcgtggtactgttaaagtc
ggcgaagagatcgaaatcgttggtatcactgaagaaactaaaaaatccgttgtaacaggc
gttgagatgttccgtaaattgttggattccgctcaagcgggtgacaacatcggtgcattg
ttgcgtggtgttgaccgtactcaaatcgagcgtggtcaagtacttgcaaaaccaggttct
gttaagccacacacagaattcacagctcaaatctacgttctgactaaagaagagggcgga
cgtcacaaaccattcttcactggttaccgtccacagttctacttccgtacaactgacgta
acaggcatcatcaacttgcctgaaggtactgaaatggtaatgcctggtgataacatcact
gttactgtttccctgatctccccaatcgcgattgaagaaggaactaaattctccattcgt
gaaggcggacgtacagtaggtgccggttccgtagcatctatccaaaaataa

DBGET integrated database retrieval system