KEGG   Plutella xylostella (diamondback moth): 105382396Help
Entry
105382396         CDS       T03915                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy03030  DNA replication
pxy03410  Base excision repair
pxy03420  Nucleotide excision repair
pxy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105382396
   03410 Base excision repair
    105382396
   03420 Nucleotide excision repair
    105382396
   03430 Mismatch repair
    105382396
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pxy03032]
    105382396
   03400 DNA repair and recombination proteins [BR:pxy03400]
    105382396
Enzymes [BR:pxy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105382396
    6.5.1.6  DNA ligase (ATP or NAD+)
     105382396
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105382396
DNA replication proteins [BR:pxy03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    105382396
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     105382396
DNA repair and recombination proteins [BR:pxy03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105382396
   NER (nucleotide excision repair)
    Other NER factors
     105382396
   MMR (mismatch excision repair)
    Other MMR factors
     105382396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 105382396
NCBI-ProteinID: XP_011550578
LinkDB All DBs
Position
Un
AA seq 903 aa AA seqDB search
MNILLRSLKRCTVVTFGNRFVYNVQPTENLLKLIVNTPASAWIIPNNTVTTMAQRSITSF
FTKTPKKSIDKDSSLDSEASPSAKDTPPSSKTSTSEDTATTNSKTPVKKSVKRQRLESSG
SESRSPQKSSPEPSPVKETKKKVKRQRIESSSSEQSQSPKKIPKEEKVSPKVEKKKSPKT
YSSPKSKKVNVKVEKVPLVERNGKADKSKDNPKQKKEKDEVKSEVVKVEIELEVAKENKF
KEEVTESKKVEETEYNPAKAKYHPIRDACWSEGQPVPYLALAKTLEAIEGTSARLKMIEI
LSNYFRSVMVLTPEDLLPSVYMCLNQLAPAYHSLELGIAETYLMKAIGQCTGRTLAQVKA
AAQKSGDLGLVAEQARATQRTMFQSKPLEARKVFQALKDVAHMTGQASVNKKIGKIQSLY
VACRNAEARYLIRSLAGKLRIGLAEQSVLQALALAATMTPPPQRDVLDASKGLTPEEFKE
KLDATALLIKTTYCECPNYDLLIPVLLQHGAAALPQHCRLTPGVPLKPMLAHPTKGVHEV
LNRFEGLEFTCEWKYDGERAQIHVPSLPVXXXXXXXXXXXTKYPDILRRLPGLLKESVSS
CVLDCEAVAYDVVNKQILPFQILSTRKRKDAVESEIKVQVCVFVFDLLFLNGASLVSRPL
RERRDLLRKHCREVEGEWHFATSVDCSTTEEVAAALDAAVRGSCEGLMVKTLSGKDATYE
IARRSRNWLKLKKDYLDGVGDTLDVVVLGGYSGRGKRTGVFGGFLLACYDPQTEEYQSLC
KIGTGFSDEDLQTLSATLKEHVIDGPRNYYRYDSSHEPDSWFAPAAVWEVRCAALSLSPA
HRAALGLVEPDKGVSLRFPRFVRVRDDKTPENATSAQQVAELYLSQDQVKNQTSKPTVQD
DFY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttattgagaagtttgaaacgatgcacagttgtgactttcggaaataggttt
gtttacaatgtgcaacctactgaaaatcttctgaaattgattgtaaatactccggcttca
gcttggattatacccaacaatactgtaaccacaatggcacaaaggagcatcacatcgttt
tttacaaaaacgcctaagaaaagcattgataaggacagcagcctggacagtgaagccagt
ccatctgccaaggatacaccaccaagcagtaaaacatccacttctgaagatactgcaact
acaaatagtaaaactccagtcaagaaatcagtgaagcgacagaggttggagagcagtggg
agtgagtcccgctccccacaaaagtcatctccagaaccatcaccagttaaagaaacaaaa
aagaaagttaaacggcagagaattgaaagttccagcagtgaacagtcacagtctcccaaa
aagatacctaaagaagagaaagtatctcctaaagtagagaaaaagaagtcccctaaaact
tactcttcccctaaatctaagaaagttaatgtcaaagtagaaaaggttccgcttgttgag
agaaatggcaaagcagataaatccaaggacaatcctaaacagaagaaagaaaaagatgaa
gtgaagtctgaggtggtcaaagtggaaatagagttggaagttgccaaagaaaataaattc
aaagaagaagttacagaaagtaaaaaagtagaagaaacagaatacaatccagccaaagcc
aagtaccatccaatcagagatgcatgctggtcagaaggccagcccgtcccataccttgca
cttgccaagacgctggaggctattgagggcacatccgctcgactcaagatgatagagatc
ctgagcaactacttcaggtcggtgatggtgctgactccagaggacctgctgccgagcgtc
tacatgtgcctgaaccagctcgcacccgcttaccatagcttggaactcggcatagcagag
acctacctcatgaaggccatcggtcagtgcacggggcgcaccctcgcccaagtcaaggca
gctgcacagaagtctggagacctggggctggtggcggagcaggcgcgcgccacgcagcgc
accatgttccagagcaagccgctcgaggcacggaaggtgttccaggcgttgaaggatgtc
gcgcatatgactggacaagcatcagtcaataagaaaattggaaagatacagtcgctatac
gtcgcctgtaggaatgctgaagcgagatatcttatcagatccctagccggcaagctgcgc
atcgggctggcggagcagtcagtcttacaagcactggctttagccgccaccatgacgcca
ccgccacagcgagacgtgctggatgcgtccaagggactcacgccggaggagttcaaggaa
aaactcgacgccacggccctcctaatcaagacaacctactgcgagtgtccgaactacgac
ctcctcataccagtgctgcttcagcacggggcggccgcgctgccccagcactgccggctc
acccccggcgtgccgctcaagcccatgctggcacacccgactaagggggtgcatgaggtg
ctcaacagattcgaaggcctagagttcacgtgcgagtggaagtacgacggcgagcgcgcg
cagatccacgtcccctccctccccgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
actaaatacccggatatattgcggagactgcccgggctattgaaggagagtgtcagtagt
tgcgtgctggactgtgaggcggtcgcgtatgatgtggtgaataagcagatattgccgttt
cagatcctgtcaacccgcaagcgcaaggacgctgtagaatccgagatcaaggtgcaggtg
tgcgtgttcgtgttcgacctgctgttcctgaacggcgcctcgctcgtgtcgcgcccgctg
cgggagcgccgggacctgctgcgcaagcactgccgcgaggtggagggagaatggcacttc
gccacgtcagtggactgcagcaccacggaggaggtggcggcggcgctggacgcggcggtg
cgcggctcctgcgaggggctcatggtcaagacgctcagcgggaaggacgccacctacgag
atcgcgcgacgcagtcgaaactggcttaagctaaagaaagactacctagacggcgtcggg
gacaccctcgacgtggtcgtactaggcggctacagcgggcgcggcaagcgcaccggagtc
ttcgggggcttcctgctcgcgtgctacgacccgcagaccgaggagtaccagagcctgtgc
aagatcggcaccggcttctccgatgaggatctccagacgctcagtgcgacgctgaaggag
catgtcattgatgggccgaggaattattacagatacgattcgagccacgagccggactcg
tggttcgcgccggcggcggtgtgggaggtgcgctgcgcggccctgtcgctgtcgcccgcg
caccgcgccgcgctggggctggtcgagcccgacaagggggtgtcgctgaggttccccagg
tttgttcgtgtccgagatgacaagactccggagaacgccacatcagcgcagcaagtggcg
gagctgtacctgtctcaggaccaggtgaagaaccagaccagcaagcccacggtgcaggat
gacttctattag

DBGET integrated database retrieval system