KEGG   Plutella xylostella (diamondback moth): 105382508Help
Entry
105382508         CDS       T03915                                 

Definition
(RefSeq) maltase A1-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00052  Galactose metabolism
pxy00500  Starch and sucrose metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105382508
   00500 Starch and sucrose metabolism
    105382508
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105382508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 105382508
NCBI-ProteinID: XP_011550707
LinkDB All DBs
Position
Un
AA seq 581 aa AA seqDB search
MRGLVVLLLAATVGAVAAETDWWQTALIYQIYPRSYMDSDGDGIGDLNGITSKLPYIQGL
GADAIWLSPIYKSPMYDFGYDIADYKDIADEYGTMADFDNLMTEAQRLGVRVILDFVPNH
TSNESEWFVRSAERNATYNDYYVWADGVADPDDPTNQLPPNNWVSIFRKSAWQYNPTRGQ
YYLHQFVIGQPDLNYRSSELREEMKNVLRFWLDKGVSGFRVDAVNMLYEVDPADFGGKYP
DEPESGIAGLTKDDYDFLNHIYTKDLDETYAVVYDWRDVLDEYKHIEYKIMMTEAYTDLN
LMIKYYGNGQRNGSIPFNFSFLGEITKNSNAKDMKHAIDRWMTYMPYGMTANWVNGNHDQ
SRLATRHGDERVDALNMLAILLPGVTLTYQGEELGMTDGYISWEETVDPQACNTDDPVNG
LAKSRDPCRTPLHWDASANAGFSTAATTWLPVASNYATVNVAVEMSATKSHYHFYRDVVS
ASKTPAVREGDLETRAISIDVLAIARLLPGEQAIVGLVNLSSEAQTVDLSSFRTLPYYLD
IVTVGVSSTQTKGTRVTKKAVTISGQTAIVLQSVARVPRLP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgagggttggtggttctgttgctagcggcgaccgtcggggcggtggccgctgagact
gattggtggcagactgcactgatctaccagatctatccgaggtcctatatggacagcgat
ggcgacggcatcggggatttgaatggtataacttcgaagctgccctacatccaggggctc
ggcgcggacgcgatatggctgtctcccatctacaagtcgcccatgtacgacttcggctac
gatatagcggactacaaggatatagcggacgagtacgggactatggcggatttcgacaac
ctgatgacagaggctcagagattgggagtccgagtgatcctggacttcgtgccgaaccac
acgagcaacgagagcgagtggttcgtgcgctcggcggagcggaacgcgacctacaacgac
tactacgtgtgggccgacggcgtcgccgaccccgacgacccgaccaatcagctgccgcct
aacaactgggtgagcatattccgcaagagcgcgtggcagtacaacccgacgcgcggacag
tactacctgcaccagttcgtcatcggccagcccgacctcaactaccgctccagcgagctc
cgcgaggaaatgaagaacgtactccggttctggctggacaagggcgtgtcggggttccgt
gtggacgccgtcaacatgctgtacgaggtggaccccgccgacttcggcgggaagtacccg
gacgaacccgagtccggtatcgccggactaacaaaagacgactacgatttcctcaaccac
atctacaccaaagatctggacgagacatacgcagtggtctacgactggcgggacgttttg
gacgagtacaaacacattgagtacaaaatcatgatgacagaagcgtacacggatttgaac
ctcatgatcaagtattacgggaacgggcagaggaatgggtctattccgtttaatttcagt
ttcttgggtgagatcacgaagaatagcaatgctaaagatatgaagcacgctatagacagg
tggatgacctatatgccgtatgggatgactgctaactgggtgaacggcaaccacgaccag
agccgtctggcgacgcggcacggggacgagcgagtggacgccctcaacatgctggccatc
ctgctgcccggggtcacgctcacctaccagggcgaagaactcggcatgacagacggctac
atctcctgggaagaaaccgtcgaccctcaggcctgcaacaccgacgacccagtcaacggg
ctggccaagtcccgggacccgtgccgcacccccctccactgggatgcctcggccaatgct
ggcttcagcacagcggctacgacgtggctgcccgtggccagtaactatgcgacggtgaac
gtggctgtcgagatgagcgctacgaagagccattatcacttctacagagacgtggtgagc
gcgagcaagacgccggcggtgcgcgagggggacctggagactcgcgccatcagcatcgac
gtgctggctatagctaggctcctaccaggagagcaagcgatagttggactagtgaacctg
tcgtctgaggcacagacggtggacctgtcatccttcaggacattgccatactacctagac
atcgtcactgtgggcgtgtccagcacacaaactaaaggaactcgcgttacaaagaaggcg
gtgaccatttcaggccagacagccattgtgctccagtcggtggctcgtgtgccgcgactg
ccctaa

DBGET integrated database retrieval system