KEGG   Plutella xylostella (diamondback moth): 105382561Help
Entry
105382561         CDS       T03915                                 

Definition
(RefSeq) adenylate cyclase type 8-like
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00230  Purine metabolism
pxy01100  Metabolic pathways
pxy04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105382561
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105382561
Enzymes [BR:pxy01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105382561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Motif
Other DBs
NCBI-GeneID: 105382561
NCBI-ProteinID: XP_011550766
LinkDB All DBs
Position
Un
AA seq 1057 aa AA seqDB search
MEELPSAVGDEDPHPDTAAVEASPREGDGDSHAPEGERLPGDGASCTAPDDQRVSDDDVD
TSAEAGNIIDPFRSEDEPVSYDGMLKTGSYYKGIYWPSITNSFKDENLECSYQRYSQRQR
QKSLIMVNVVDLCLKICLSKIYALTMRNSDDFPMYQIAWTVTFSCLNVAVCLLGSWRCFA
NNYLHWAAACTWILLIGQALSGQGIGFQAPEHQVWYMLFIVFVPYAMLPLSLGWCIVIGW
LSSVSHVLATAVDIREIMDRHPQAASSCGVRMLVGNMLLYSAVNFAGMYAKYLADWGQRK
AFLETHRSMVTRQRTKRESDRHWRLFQSVIPDFLAKEIYNHVSKVKGDFQEQQFNNFYIQ
RHQDVSILFADIKGFTELSSKCSAQELVKLLNELFARFDRLASENHCLRIKLLGDCYFCV
SGLPEPRADHAHCTVNMGLHMIRAIRDVRYNAQVDLDMRIGIHSGAVLCGVLGLLKWQFD
LWSQDVTLANHMESAGLPGRVHISAATLECLDNAFEVEPGEGETRNAYLRDQGITTYLVK
TTELPRRTRHRSKPSIQPPTQPTVDTTPRRISNSIDDETTTDWTPELPFQNYYTSHVMAN
GFLNRGRGFRTKAEDIEQGPDNDEVPAIVEEEDIINHSIEVSSNREMRCREMAPWSLRFR
QPSLELSFTCLEERTFKSNLMCCLILWLFIVAVHYVIHYNCKFLVLILLLMTVPLALSFT
IIMLEEFNVKLPKLKMVSSWISGSRMRRSVHICTFITVMSISSTIKLYVCPDSFPETEAT
SNNTTNNNTTSNATFRKSIIHLFNTEEAINGECYRPEYVVFTWIICLVALTSILKLYYLI
KTLLAFVNVAIYAGLLLTYYDVYYFDWQGANAELPFYVQMLILMIVFLVMVVYHARLIEV
TSRLDFLWKLQAETDLQEMKETQRTNRCLLKHILPDHVVNHFLSKDRCPDELYSQWRDEV
GVMFAGIPNFHEFYSEQKAVDCMRLLNEIIFDFDKLLSQPRFKSIEKIKTIAATYMAASG
LNPDDKVGQGFVKMTEFHCPPLVVKYDGKPLQAGLLQ
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgccctcggccgtcggggatgaagacccgcatcctgacactgctgcagtg
gaggcgtctccgcgggagggcgacggcgacagccacgcgccggagggcgagcgtctgccg
ggcgacggcgccagctgcaccgcgcccgacgaccagagagtcagtgatgatgatgttgat
acaagtgcagaagctggaaacattatagatccttttagaagtgaagatgaaccagtttcg
tacgatggcatgctgaagaccggaagttattacaaaggcatatactggccttccattact
aatagttttaaggatgaaaatttagaatgttcgtatcaaaggtattcgcagagacaaagg
cagaaatctctaattatggtgaatgttgtagatttatgtttaaagatatgtttatcaaaa
atttacgcgctgaccatgagaaatagtgatgacttcccgatgtaccagatcgcgtggacg
gtgacgttctcgtgcctcaacgtggccgtgtgcctgctgggctcgtggcgctgcttcgcc
aacaactacctgcactgggccgccgcctgcacctggatcctgctcattggacaagcgctc
agcgggcaaggcatcgggttccaggcgccggagcaccaggtgtggtacatgctgttcata
gtgttcgtgccctacgccatgctgccgctgtccctcggctggtgcatcgtgattggctgg
ctgagctccgtgtcgcacgtgctggccaccgccgtggatatacgggagatcatggacaga
cacccgcaagctgcgtccagctgcggcgtgcgcatgctggtgggcaacatgctgctgtac
agcgccgtcaacttcgccggcatgtacgccaagtacctggccgactgggggcagcgcaag
gccttcctcgagacgcaccgctccatggtcacccggcagaggaccaagagggaaagcgac
aggcactggaggctgtttcagtcggtgataccagactttttggcgaaggagatttacaat
cacgtgtccaaagtgaagggagacttccaagaacaacaattcaacaatttctacatacaa
agacatcaagatgtttcaattttgtttgccgatattaaaggatttacagaactttccagt
aagtgtagcgcacaagaactagtcaaactactcaacgaacttttcgcaaggtttgataga
ttggcttcggagaaccactgcctgcgcatcaagttgctcggcgactgctacttctgcgtg
tcggggctgccggagccgcgcgccgaccacgcgcactgcacagtcaacatggggttgcac
atgatccgcgccatccgcgacgtacgctacaacgcacaggtggacctggacatgcgcatc
ggcatccacagcggcgcggtgctgtgcggcgtgctggggctgctcaagtggcagttcgac
ctgtggtcgcaggacgtcacgctcgccaaccacatggagagcgccgggttgcccggtcgc
gtgcacatctcagccgcgacgctggagtgcctggacaacgcgttcgaggtggaaccaggc
gagggcgagacgaggaacgcctacctgcgcgaccagggcatcaccacctacctggtgaag
accaccgagctgccgcgccgcacccggcatcggtccaagccgagcatccagccgccgact
cagccgacagtggacaccaccccgcggcgcatcagcaacagcatcgacgacgaaaccacc
acggactggacgccggagctgcccttccaaaactattacacgagccacgttatggctaac
gggtttctaaaccgtggacgtggcttcagaacgaaagcagaagacatagaacaaggacca
gacaacgatgaagtgccagcaattgtggaggaagaagacataataaaccactccatagaa
gtgagcagcaaccgcgagatgcggtgccgcgagatggcgccgtggtcgctgcggttccga
cagccctcgctggagctgagcttcacgtgcctcgaggaacgcaccttcaagtccaacctc
atgtgctgcctcatactgtggctgttcattgtggccgtgcattatgttattcattacaac
tgcaagttcctggtgctgatcctgctgctgatgacggtgccgctcgcgctgtcgttcacc
atcatcatgctagaggagttcaacgtgaagctgcccaagctcaagatggtgtcgtcgtgg
atcagcggctcgcgcatgcgccgcagcgtgcatatttgcacctttatcactgtcatgtcg
atttctagcaccataaaactctacgtctgcccagactccttcccagaaacagaagcaacc
agtaacaacactacaaacaacaacaccacatccaatgccactttcagaaagtccataatt
cacctcttcaatacagaagaggcaataaacggcgaatgctaccgccctgaatatgtggtg
tttacgtggataatctgcctggtggcgctgacttcgatcctcaagttgtattacctgatc
aagacgctccttgcatttgtgaatgtggccatttacgctggcctgctgctgacctactat
gacgtctattactttgactggcagggggctaacgcagagctgccattctacgtgcagatg
ctgatcctgatgatagtgttcctggtgatggtggtgtaccacgcgcggctaatcgaggtg
acgtcacgcctggacttcctctggaagctgcaagctgagaccgacctgcaggagatgaag
gagacgcagcgcaccaacagatgcctgctcaagcacatactgcctgatcacgtggttaat
catttcttgtcgaaggatcgatgtcctgatgagttgtactctcagtggcgcgacgaggtg
ggcgtgatgttcgcgggcatccccaacttccacgagttctacagcgagcagaaggccgtc
gactgcatgcgccttctcaacgaaataatttttgactttgacaagctgctgagtcagccg
cggttcaagagcatcgagaagatcaaaaccatcgcggctacttacatggctgcttctgga
ctcaacccggatgacaaggtgggccaaggctttgtaaaaatgacggaattccattgccct
cctctcgtcgtcaaatacgacgggaaaccgcttcaggcagggctgctgcagtaa

DBGET integrated database retrieval system