KEGG   Plutella xylostella (diamondback moth): 105383124Help
Entry
105383124         CDS       T03915                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy04146  Peroxisome
pxy04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105383124
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105383124
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105383124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105383124
NCBI-ProteinID: XP_011551442
LinkDB All DBs
Position
Un
AA seq 210 aa AA seqDB search
MIMKSLIVVLAAAAVALADHEDVGQPLRAITRISSPHSELVQGNLTFTQLPDGKVRVEGV
VLGMTHGLYGMHVHEKGDITGGCLSTGGHFNPEHKNHGHPNDEDRHVGDLGNLEFDENRI
GRVDFVDSKICLSGPHSILGRAIVLHEKADDFGRSSHPDSKKTGNAGGRVACGVIGILDP
VGGWHTGASSRPSLASIVLAPIAALLLLVH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaagagcttgatcgtagtgttggctgcggcggcagtggccctggctgatcat
gaggatgtgggccaaccgctccgcgccatcacccgcatctcctcacctcacagcgagctg
gtgcagggcaacctgaccttcacccagctgcctgacggcaaggtccgagtggagggcgtg
gtgctcggcatgacccacgggctctacggcatgcacgttcatgagaagggagacatcact
ggagggtgtttgtccactgggggacacttcaatccagagcataaaaaccacggccacccg
aacgacgaagaccgccacgtgggagacctaggaaacctggagttcgacgagaacaggatc
gggcgtgtagacttcgtggacagcaagatctgcctgtccgggccccacagcatcctgggc
cgcgccatcgtgctgcacgagaaggcagacgacttcggaagaagctcgcaccctgactcc
aagaagaccggcaacgctggggggagagtggcttgcggcgtcatcggaatcctagaccca
gtgggcggctggcacacgggcgcgtcatcgcggccctccctggcttccatcgtcctagca
cctatcgccgctctgcttctactggttcattag

DBGET integrated database retrieval system