KEGG   Plutella xylostella (diamondback moth): 105384048Help
Entry
105384048         CDS       T03915                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105384048
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pxy03036]
    105384048
Enzymes [BR:pxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105384048
Chromosome and associated proteins [BR:pxy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105384048
   HMT complexes
    COMPASS/SET1 complex
     105384048
    COMPASS/SET1 complex (yeast)
     105384048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 105384048
NCBI-ProteinID: XP_011552510
LinkDB All DBs
Position
Un
AA seq 1425 aa AA seqDB search
MNGGMEQKTPGHNAALHKAPKNYKLLMDPFLVKGATKLYRYDGCVPGDSSFPPVQCRDPR
SQLSRIWNRLEPADLPVPRFKIDKNYVGVPPQLEITIANLNDNIDKAFLSDMMNKVGPYE
ELTIFYHPITNRHLGFARIVFHEVKHSKLCIEKYNGKSVMGQVLEVFHDAFGKKCQEMFE
SKTTERKPPPVVPPVAKLPPPGVVEDLRGKDPSLSKRLEDTKIVEKQAEPYPPHPTHPAR
YKEVEQSDSSSRWSDEERDYRTGHRHRSRSERDRDKDRDRDRTKPQTFKTHFCIWNLNFL
TLVTKLERRSGTTPAPQWATPATPIMKEHSSPLEIKEKKEIKPQKEAAPEAPEVPESAAM
SDAPAEEPPPPGEPPGKNVDLDTRIAMLLKGAGGGGGMAPPFLSLGVSSEEEDERHLPAK
IPDLDAPQPPSDDEGAEGAGGGGGMAPPFLSLGVSSEEEDERHLPAKIRDLDAPQPPSDD
EVSGSSGRSMISLAQAREVNPEPLSNTPSPYLTREFYLECLRITVEKASPSPAPFSQPPP
VTPQQELDNPHFPTINSVIERITAELKQILKRDFNKKMIELTAFKNFETWWDEQSRKQTA
PKPVKTGETQQPLQDISNKKEESVDTIKSIMESREMRAGCGLGSGLGLRAAIPKMPSFRK
KRKIPSPVTMDEDSKRGSDQEEMVQNSDEEKEVPPPPRRQSSSSSRSSSSSSSRSSSSAS
SSPRRQAPRIYSDSSDGSLDESQFQLRANKERLRRVYSSSESEAERAREKTPIPEVEADE
HLAASPQRSPARRDRTADSDTDDFQPYKREKPSTTEAKAEKSPPPAASLLDRIYSDSEEE
REYQERRRRNTEYMEQIEREFKEEQLRSAGAREDKPDAKYDDCHVRLSRMADLPHDSKPE
TKTESKPKISEEPKIERQSPVSNHLKSPEKKKKEAEEGEITSDEEMLESRRKKDTKKKRK
KPQKREEKEKEREKQREKEKEKQRERVVSLSDDQSNTDTAPSMNGIMDDGGLSETSSPQS
QASQASQASQVALEHSYCRPPTDDAPSTANHLQHDHGYTWMTQEPGAEPVVVEKKLPEPK
KEKRPYKRKHETTKLAEIQNKLYDGRGDVRPKFDHITFKTRDIMAEMQVMYEFLTRGIDR
EDIEYLKRAYETLLAEDAQGYWLNDTHWVDHPPTDVRYSPPKKKSKRHNNMYEDLQGHKS
GSARTEGYYKMDSKLKAKYKYHHGRGVASATPLEAAQEQDKKAAMISKMQHMSREARSNQ
RRLLTAFGTDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAQEPIAADEMVIEYVGQMI
RPIVADVREAQYEATGIGSSYLFRIDFDTIIDATKCGNLARFINHSCNPNCYAKIITIES
QKKIVIYSKQPIGVDEEITYDYKFPLEDEKIACLCGAPQCRGFLN
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaggaatggagcagaaaacgccaggacacaatgctgcgcttcacaaagcacca
aaaaactacaagttgctcatggacccattccttgtgaaaggagcaacaaaattgtacaga
tatgatggatgtgttccgggggattcaagcttcccccccgtgcagtgcagggacccccgg
tcccagctgtcgcggatctggaacagactggagccagctgatctgccagtccctagattc
aaaattgataagaactatgttggagtgccacctcagttggaaataactatagcaaatctc
aatgataacattgataaggcatttttaagcgatatgatgaataaagttggaccttatgaa
gagcttaccatattctatcatccaattacaaataggcatttaggatttgctagaattgtt
tttcatgaagttaagcattctaaactatgtattgaaaaatacaatgggaaatctgttatg
gggcaggtgctagaagtgttccatgatgcttttggcaaaaaatgtcaagagatgtttgag
agcaaaacaacagaacggaaaccaccacctgtggtgccgccggtggccaagctgcctccg
cccggagtggtggaagacttgaggggcaaagatccatcgcttagcaagcggcttgaagat
accaagatagttgagaagcaggcagagccgtaccccccacaccccacacaccccgcgcgc
tacaaggaggtggagcagagcgacagcagctcgcgctggtcggatgaggagcgcgactac
agaacgggacaccgccaccgcagccgcagcgagcgagacagggacaaggatagggataga
gacagaacaaaacctcaaaccttcaaaactcatttttgtatttggaacttaaacttttta
actcttgtaacgaagctggagcgtcgctcgggcaccacccccgccccgcagtgggcgacg
ccagcgacacctatcatgaaggagcattcgtccccgctagagatcaaagagaagaaggaa
atcaaaccgcaaaaggaggcggcccccgaggcgccggaggtaccggagagcgccgcgatg
agcgacgcgccggccgaggagcccccgccgccgggcgagccgcccgggaagaatgtcgac
ctggatactagaatagcgatgctactaaaaggcgcgggcggcggcggcggcatggcgccc
ccgttcctctctctcggagtttcttccgaggaggaggacgagcgccacctgccggccaag
atccccgacctggacgcgccgcagccgccctccgacgacgaaggtgctgaaggcgcgggc
ggcggcggcggcatggcgcctccgttcctctctctcggtgtttcttcagaggaggaggac
gagcgccacctgccggccaagatccgcgacttggacgcgccgcagccgccctccgacgac
gaagtgtcaggcagctcggggcgcagcatgatctcgctggcgcaggcgcgggaggtgaac
ccggagcctctctccaacacgccgtcgccctacctcacgcgcgagttctacctcgagtgt
ctgcgaatcaccgtggagaaggcctccccctcccccgcgcccttcagccagccgccgccc
gtcacgccacagcaggaactcgacaacccgcacttcccgaccatcaacagcgtcatagaa
cgcatcacagcggaactgaagcagatcctgaaacgagacttcaacaagaagatgatcgag
ctgacggcgttcaagaacttcgagacgtggtgggacgagcagagccgcaagcagactgcg
cctaaaccggtcaagacgggcgagacgcaacaacctttgcaggacatatcaaacaaaaaa
gaagaatccgtcgacacaataaagtcaataatggagtcgcgcgagatgcgcgccggctgc
ggcctcggcagcggcctcggcctgcgcgccgccatccccaagatgcccagcttcaggaag
aagaggaagatcccctcgcctgtcactatggatgaagatagcaagcggggcagtgatcag
gaggagatggtgcagaactccgatgaagagaaggaggtgccgccgcccccccgccgccag
tccagcagctcctccagatcctcctcctcatcgtcgtcgcgctcctcctcatcggccagc
tcgtcgccgcggcggcaagcgccgcgcatctacagtgactcgtccgacgggtcgctggac
gagtcgcagttccagttgagggccaacaaggagcgcctgcgacgcgtgtactcgagcagc
gagagcgaggccgagcgggctagagaaaagacgcctatccccgaggtggaggccgacgag
cacctggccgcgtcgccgcagcgctcgcccgcgcgccgcgaccgcaccgccgactccgat
acggatgacttccagccctacaagcgggagaagccgtctaccacagaggcgaaggcggag
aagtccccgcccccagccgcgtcccttctcgaccgcatctactcagactccgaggaggag
agggagtaccaggagcgaagacgtcgcaacacagagtacatggagcagatcgaacgcgag
ttcaaggaggagcagctgcgctctgcgggcgcgcgggaggacaagcccgacgccaagtac
gacgactgccatgttcgcctgagcaggatggcggacttgccgcatgatagtaaacctgaa
accaaaaccgaaagcaaacccaagatctcggaagaacccaagatcgagcgacaaagccca
gtctcgaaccatctgaaatcccccgaaaagaagaagaaagaggcagaggaaggggaaatc
acgtcagacgaagaaatgctcgaatcacgacggaagaaagacactaagaagaagagaaag
aagccccagaagagagaagaaaaggagaaagagagggagaagcagagagaaaaagagaag
gagaaacagcgggagagagtggtgtctctgtctgacgatcaaagtaatacggataccgct
cccagcatgaacggtattatggacgatggcggtctatctgagacctcatcaccccagtcc
caagcatctcaagcgtcgcaggcgtcgcaggtcgcgctggagcactcgtactgccgcccg
cccaccgacgacgcgccgtcgacggccaaccatctgcagcatgaccatggttacacatgg
atgacgcaggagccgggcgcggagcccgtcgtcgtggagaagaagcttccagaacccaag
aaggagaagaggccctacaagagaaaacacgagactaccaaactagccgaaatacaaaac
aaattatacgatggtcggggcgacgtgcggccgaaattcgatcatatcacgttcaagaca
cgagacattatggctgaaatgcaggtcatgtacgagttcttgacgcggggcatcgaccgg
gaagacatcgagtacttgaagagagcgtacgagacgttgctagcggaagacgcgcagggc
tactggttgaacgacacgcactgggtggaccacccgcccactgatgtaagatactcgccg
cccaagaagaagtccaagcgacataacaacatgtatgaggatctacagggacacaagagc
ggctcagcgcgtacagaaggctactacaagatggactccaagctcaaggccaagtacaag
taccaccacggccgcggcgtcgcgtcggccacgccgctggaggccgcacaggagcaggac
aagaaggccgccatgatcagcaagatgcagcacatgtcgagagaggcgaggtctaaccag
aggaggctgcttactgctttcggtactgacacggactctgatctgctcaagttcaaccag
ctcaagttcaggaagaaacaactcaagttcgccaagtccgggatccacgactggggattg
ttcgctcaggagccgatagcagcggacgagatggtgatcgagtacgtggggcagatgatc
cggcccatcgtggcggacgtgcgtgaggcgcagtacgaggccaccggcatcgggtcctcc
tacctgttccgtatagacttcgacaccatcattgatgcgaccaaatgcgggaacttggcc
aggtttatcaaccacagttgtaatccgaactgctacgcgaagatcatcacgatagagtct
cagaagaagatcgtgatctactcgaagcagccaataggcgtcgacgaggagatcacgtac
gactacaagttcccgctagaagacgagaagatcgcgtgcctgtgcggcgcgccgcagtgc
cgcggcttcttgaactag

DBGET integrated database retrieval system