KEGG   Plutella xylostella (diamondback moth): 105384625Help
Entry
105384625         CDS       T03915                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00061  Fatty acid biosynthesis
pxy01100  Metabolic pathways
pxy01212  Fatty acid metabolism
Module
pxy_M00082  Fatty acid biosynthesis, initiation
pxy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105384625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pxy01004]
    105384625
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxy04147]
    105384625
Enzymes [BR:pxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     105384625
Lipid biosynthesis proteins [BR:pxy01004]
 Fatty acid synthase
  Animal type
   105384625
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105384625
  Exosomal proteins of breast milk
   105384625
  Exosomal proteins of colorectal cancer cells
   105384625
  Exosomal proteins of bladder cancer cells
   105384625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KR Thioesterase PP-binding ADH_zinc_N_2 adh_short adh_short_C2 Abhydrolase_8 Ad_Cy_reg
Motif
Other DBs
NCBI-GeneID: 105384625
NCBI-ProteinID: XP_011553200
LinkDB All DBs
Position
Un
AA seq 781 aa AA seqDB search
KLTPQASVRCLGYRGRFLEIGKFDISNNTPIGMHFFLKETSFHGIMLDYIFDQSFDFRKR
LQDLLLTGIESGAVRPLTYCTFEKQEVETAFRYMAAGKHIGKVIIKIRDEERSHRPVRPT
AFPVDAVPRYMCQEDYVYVIVGGLGGFGLELADWLIMRGARRLMLSSRRGISNGYQASRL
KAWAGYGADVQICTADVTTAEGCEELLVQSNKMGKVEAIFNLAVILKDSVFANQSPETFK
TSFAPKAIATMHLDRLSKKLCPNLHDFVVFSSVSCGRGNAGQTNYGMSNSVMERICEWRK
KLGLPALAVQWGAIGDVGLVADTQDDDVQLEIGGTLQQRISSCLLALDKFLKQDEPIVSS
IVVAEKKAGGSGCGNIVDAVAQIMGIKDLKTVSQQVSLAELGMDSMMAVEIKQTLEREFE
IFLTAQDIRTLTFARLVELTAAREEAASTSASRLAAPEGAAGLRVFMRNFGDENLASEPF
IYMPTMVTDAKEGEEALLETENLMFMIPGLEGCAAVLEPLCRRLKTQVCVLQLGLEHRNE
TGAEMVDRLHQTINTRLSPGAPFTLLGYSFGCQLTLGLAKKLENEGHKGTVFCLDGSPDF
LSSILSMTMSVKNDVQLQNSIICHTIDIVAPNNDVTLNLMEKLNEIESYDERVAYAIKVS
PVQSKYSNYFIAATAAVCFDRLKGVMNFNPKTFEKIKSPITLLRPKENPPGVVLEENYGL
DKFTEGAVTVHYLEGNHVSIIENKDVANIINRVILDKEAPGKLAGNVVTSMVETQRSVKA
E
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
aaattaacccctcaggcgtcggtccgctgtctcggctaccgcggccgcttcctcgagatc
ggcaagttcgacatcagcaacaacactcccatcgggatgcacttcttcctcaaggagacc
tcgttccacggcatcatgttggactacatcttcgaccagagcttcgacttcaggaagcgt
ctccaagacctgctcctaacgggaatcgaatccggagcggtgcgcccgctcacctactgc
acattcgagaagcaggaagtggagactgccttccgctacatggcggccggcaagcacatc
gggaaggtcatcatcaagatcagggatgaggagaggagccacaggccggtgaggcccact
gccttccctgtcgacgctgtgcctagatacatgtgccaagaagactacgtgtacgtgatc
gtgggcgggctgggcggcttcgggctggagctggcggactggctcatcatgcgcggcgcc
aggaggctcatgctgtcctctaggcggggcatttccaatgggtaccaggcgtcgaggctt
aaggcatgggctggctacggcgccgacgtgcagatctgcacggccgacgtgaccacggcc
gagggctgcgaggagctgctggtccagtccaacaagatgggcaaggtggaggccatcttc
aacctggccgtcatcttgaaggactcggtcttcgccaatcagagccctgagacgtttaag
acgtcgttcgcgccgaaggcgatagcgactatgcacttggacaggctgtcgaagaaattg
tgcccgaacttgcatgacttcgtagtcttctcctcggtgtcctgcggtcgcggtaacgcc
gggcagaccaactacggcatgtccaactccgtgatggagaggatctgcgagtggaggaag
aagctggggctgcccgcgctcgccgtgcagtggggcgctatcggagacgtgggtctagta
gcagacacgcaagacgacgacgtgcaactcgagatcggaggcaccttacaacagcgcatc
tcctcgtgtctcctcgcgctggacaagttcctgaagcaggacgagcccatcgtgtcctcc
atcgtggtggccgagaagaaggctggagggtctggttgtggaaacattgtggacgctgtt
gcgcagattatgggtatcaaggacctgaagacggtctcacagcaagtctccctcgccgag
ctcggcatggacagcatgatggcggtggagatcaagcagacgctggagagagagttcgag
atcttcctcaccgcgcaggacatcagaactttgacttttgccagactagtagagctaacc
gccgcccgcgaggaagcagcctccacatccgcctcgcgcctcgcagcccccgagggcgcc
gccggcctgcgcgtgttcatgaggaacttcggggacgagaacctcgcgtccgagcccttc
atctacatgcctactatggtcactgatgctaaggagggcgaggaggcgctcctagagaca
gagaacctgatgttcatgatccccgggctcgaggggtgcgcggcggtgctggagccgctg
tgccgccggctcaagacgcaggtgtgcgtgctgcagctcgggctggagcacaggaacgag
accggggctgagatggtggatcggctgcaccagacgatcaacacccgcctgtcgcccgga
gctcccttcacgctgctcggatacagtttcggttgtcagctcaccctcggcctcgccaag
aaactggagaatgaaggtcacaagggcaccgtattctgcctggacggctcgccggacttc
ctctcctccatcctcagcatgacgatgagcgtgaagaacgacgtgcagctgcagaacagc
atcatctgccacaccatcgacatcgtggcgcccaacaacgatgtcacgcttaacctcatg
gagaagctcaacgagatcgagtcttatgatgagcgagtcgcctacgccatcaaggtgagc
ccggtgcagagcaagtactccaactacttcatcgcggcgacggctgccgtatgcttcgat
aggctgaagggggtcatgaacttcaacccgaagaccttcgagaagatcaagtcgcccatc
accctgctcaggcctaaagagaacccgccaggcgttgtcctagaagagaactacggtctg
gataagttcactgaaggagcggttaccgtgcattatttggagggtaatcacgtgagcatc
atcgagaacaaggacgtggccaacatcatcaaccgggtgatcctggacaaggaggcgccg
ggcaagctggccggcaacgtggtcacctccatggtcgagacgcagaggtccgtcaaggcg
gagtaa

DBGET integrated database retrieval system