KEGG   Plutella xylostella (diamondback moth): 105385433Help
Entry
105385433         CDS       T03915                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00020  Citrate cycle (TCA cycle)
pxy00190  Oxidative phosphorylation
pxy01100  Metabolic pathways
pxy01200  Carbon metabolism
Module
pxy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105385433
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105385433
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105385433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 GIDA HI0933_like DAO FAD_binding_3 Thi4 NAD_binding_7 FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105385433
NCBI-ProteinID: XP_011554120
LinkDB All DBs
Position
Un
AA seq 331 aa AA seqDB search
WLASSTRKIVGRKIRTPITGSTRNGSYSITHHQHDCLVLGAGGAGLRAAIGLAEAGFSVA
VVSKLFPTRSHTIAAQGGMNASIGSMHEDKYQYHFYDTVKGSDWLGDQDSIQYLTREAPH
VVYELENMGMPFSRTKDGKIYQRAFGGATVCFGQKPAKRTCAVEDRTGHALLHTLYGYST
KFDNIEFFTDFFVLDLLKQDDAMVGALALNMDTGCLHRFQAGNTVIATGGYPRLYFSCTA
AHTATGDGCALFTRKGLPLQDMEFIQFHPTGMYGSGCLMTEGCRGEGGFLVNSAGERFME
KYAPSAKDLASRDVVSRSIATEIREGTPVDC
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
tggttggctagttccacgaggaaaatagttggtcgcaaaatacgaactcctattaccggg
tctacccgcaatggttcctactccatcactcaccaccagcacgactgtctggtgctgggc
gcgggcggcgcggggctgcgcgcggccatcggcctggccgaggctggcttcagcgtggcg
gtggtctccaagctgttcccgaccaggtcgcataccatcgcggctcagggcggcatgaat
gccagtataggaagtatgcacgaggacaaataccagtaccatttctacgacacagtgaag
ggctctgattggctgggagatcaggactcaatacaatacctaacccgagaggctcctcac
gtggtctatgagctggagaacatgggcatgccgttttccaggacgaaggacggcaaaatc
taccagcgcgcgttcggaggagccaccgtttgcttcggacagaaacccgctaagaggact
tgtgctgttgaagatcgaacaggtcacgcccttctccacaccctatacggatacagcaca
aagtttgacaatatcgagtttttcaccgacttctttgtgctggacttgttgaagcaagac
gacgccatggtgggggctttagcccttaatatggacacagggtgccttcacaggttccaa
gccggcaacaccgtcatagccaccggcggctacccccgcctgtacttctcatgcacggca
gcgcacaccgccacgggcgacgggtgtgcgctcttcacccggaaggggctgccgctgcag
gacatggagttcatacagttccatcccaccggtatgtacggctccggctgcctaatgacg
gagggctgtcgcggcgagggcggcttcctggtgaacagcgctggcgagcgcttcatggag
aagtacgcgccgagtgccaaggacctggccagccgggatgtggtgtccaggtctatagct
acggagatccgggaaggtacccctgtagattgctaa

DBGET integrated database retrieval system