KEGG   Plutella xylostella (diamondback moth): 105385613Help
Entry
105385613         CDS       T03915                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00040  Pentose and glucuronate interconversions
pxy00051  Fructose and mannose metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105385613
   00051 Fructose and mannose metabolism
    105385613
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105385613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-GeneID: 105385613
NCBI-ProteinID: XP_011554326
LinkDB All DBs
Position
Un
AA seq 358 aa AA seqDB search
MSQDNLTALLLKPKDLQLVQTKIPEIADDEVLLRMDCVGICGSDVHYWQTGACGHFVLKE
PMVMGHEASGVVAKIGSKVKNLKPGDRVAIEPGVPCRVCEFCKTGRYHLCPDIAFCATPP
FHGNLVRYYKHAADFCYKLPDHVSMEEGALLEPLSVGIHACRRGGVTAGASVLVLGAGPI
GLVTLLAARAMGASNILITDILQSRLDFAAKLGANHTLLVTRDLSEADLVRKVHELMGTH
PDISIDASGAQATVRGALLATKSGGVAVLVGMGSPELTVPLAGAVAREVDIRGIFRYVNE
YPIALSMVSSGLIDVKPLVTHHFSMEETLQAYETARRGDGIKVMIHVQPRDANNVKKF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggacaacctcaccgctttgctgctgaagcccaaggatttacagctggttcaa
accaagatccctgaaatagccgatgatgaggtcctgctccgcatggactgcgtgggcatc
tgcggctccgacgtgcactactggcagaccggcgcctgcggacacttcgtgttgaaggag
cccatggtcatggggcacgaggcgtcgggggtcgtggctaagatcggttcaaaagtgaag
aacctcaagcccggggaccgtgtggccatcgagccgggtgtcccgtgccgcgtgtgtgag
ttctgcaagactggccgctaccacctgtgccccgacatcgcgttctgcgccacgccgccc
ttccacggcaacttggtgcgatattataaacatgccgctgacttctgctacaaactcccc
gaccacgtatcaatggaagaaggcgcgctcctagagccgctctcagtgggcatccacgcg
tgccggcgcggcggggtgacggccggcgccagcgtgctagtgctgggcgccgggcccatc
ggcctggtgacgctgttagccgcccgcgctatgggcgcgagtaatatacttattactgac
atcctacaatcccgcctggacttcgccgctaagctgggtgcgaaccatactctcctggta
actcgggacctgtctgaggcggacttagtgcgcaaagtgcatgagctgatggggactcac
ccagacatcagcattgatgccagcggggcgcaggccaccgtgcggggagcgctactggcc
accaaatccggcggtgtagcagtattagtgggcatgggtagtcccgagctgacggtgcca
ctagccggcgccgttgcacgggaggtcgacatacgaggcatcttccgatatgttaacgag
tacccaatagccctgagcatggtgtcttcaggcctgatcgacgtgaagccgctagtgacc
caccacttcagcatggaggagactcttcaggcctacgagaccgcccgccgcggcgacggc
atcaaggtcatgatacacgtgcagccacgggacgctaataatgtcaagaagttttag

DBGET integrated database retrieval system