KEGG   Plutella xylostella (diamondback moth): 105385777Help
Entry
105385777         CDS       T03915                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00052  Galactose metabolism
pxy00500  Starch and sucrose metabolism
pxy01100  Metabolic pathways
pxy04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105385777
   00500 Starch and sucrose metabolism
    105385777
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105385777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxy04147]
    105385777
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105385777
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105385777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 105385777
NCBI-ProteinID: XP_011554511
LinkDB All DBs
Position
Un
AA seq 1131 aa AA seqDB search
MPKIPYKPDKTGDDDEDYEIVSFEDFCDKSPGSKTDLLTLNDNINYRLCYESDKGSKAED
EGEPSGKDAQELRETSLGGGKNVSWKRRGSSSFAPFGRHNATNNKGSLFSGVVPKPKNEG
ESSREHRYQRFSAQATFYQRLVEFWQQCGSTLILMALVGVLCVAVWVGVVSLVGAGGDQH
YRKLWERAHHADLLAAAAAATTEKPTPEHHYHDHNNLSTKNKLNITDKYRKKPELNKKSY
MERPLATLNGLCSKVTTDRRFDCFPQDGASEEGCIKRGCCWNATTTKYGSLGKPYCFYPP
DYDTFHFVNMSETRHGISVCLERMRPSGYPGDFDLVNMDFKYLSNGALQIKIYDAENKRF
VPPYPEIPLVTGPINNLKYRVVVESATVGFKVIRNDDNVTILDSQNVGGMILSDKFLQMS
TLLPTNKIYGIGERQGPLRVDMNWQVYTIFNSDSVPVENTPLYGSHPFHLGLEDSGKSHG
MVLLNSNAMDIVTQPTPALTYRTIGGILNFLLVLGDAPNDVLAEYTALVGRPAMPPYWAL
GFHLCKFNYGSLNVTRDVWQKNRDAGLPFDVQWNDLDYMSDSNDFTYDTERFAGLPQFVR
ALHRQHMHYVVLIDPGISSSEKPGEYPPFDRGLELDIFIKNSSNMPFVGKVWNKQTTVWP
DFTHPSAQAYWLEMLKSLHDQVPFDGAWIDMNEPSNFLSGPMYGHCEPEDLPYVPHGIRG
DGLKTKTLCMDAKHYAGSHYDWHNLYSITESIATNFAMTELRGSRPFIISRSTFVGSGRH
AGHWSGDVASAWHDMRMSIPEMLAFSLFGVPLMGADICGFRGNTTVELCTRWMQLGAFYP
FSRNHNSDTSIPQDPASLGPAVLEASIRILRVRYSLLPLYYTLFWRAKDSGATVARPLFA
EFPTDPLTHDIDTQFMIGPSIMIAPILQPNTTSTQAYLPDDLPWLVLTTEKKAPNKYVTI
HEHGTVLVRPGSSESLQLIVLELLEDSSGKAYGELYWDDGDSLNSYEEKKYSHIEFYKQS
TSVNSAVQWWGYGVPTVNNITIYSIEYPVKTVELNDQPCKKPLCEFSYDAKDHILRVYNM
NLSLDKPFSLTWTNKNSYPKLIVPNGGGHLAMVNETVVDCRYADCTEIKKR
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaataccttacaaaccggacaaaaccggcgacgacgatgaggactacgagata
gtgtccttcgaagatttctgcgacaagtctccgggctcgaagacggatttgttgactttg
aatgacaatatcaactatcggctttgttatgagagcgataagggctctaaagctgaggac
gagggtgagccgtcgggtaaagacgcccaggagttgagggagacgtccctgggcggaggg
aagaatgtgtcgtggaagaggagagggtcgtcatccttcgcgcctttcggaaggcacaat
gctactaacaacaaggggtcactcttcagtggtgtcgtccctaagccgaagaatgagggt
gaatcgtccagagagcatagataccagcggttctcggcccaagccaccttctaccagcgt
ttggtggagttctggcagcagtgtggctcaacactgatcctcatggcgctagtcggggtg
ctctgtgtggcggtgtgggtgggcgtggtgtcgctggtcggtgcgggtggtgaccagcat
tacaggaagctgtgggagcgagcgcatcatgcggatctgctggctgctgctgctgctgct
actacggaaaagcctacccctgagcatcactaccacgatcacaacaacctgagtacaaag
aacaagttgaacataacagacaagtacagaaagaaacctgaactgaacaagaagagttat
atggaacgcccgctagctacccttaatggattgtgttctaaagttactacggatcgacgc
ttcgattgttttccacaagatggcgccagtgaggaagggtgtattaaaagaggttgctgc
tggaacgccaccacaacaaaatacggatccctcggcaagccgtactgcttctacccgccg
gactacgacacattccactttgtaaatatgagcgagacccgacacggcatatccgtgtgc
ttggagaggatgcgtccgtcaggatatccgggtgattttgatctggtcaacatggacttt
aagtatctgtctaatggggcgctgcagattaagatatacgacgcagagaacaagcgcttc
gtgcccccgtaccccgagatcccgctagtgacggggcccatcaacaacttgaaatacagg
gtggtggtggagagcgccacggtcgggttcaaggtcatcaggaacgatgataatgttacc
atattggatagccaaaatgttggtggaatgattctctcggacaaattcctgcaaatgtcg
accttactgcctacgaataagatctacggtatcggtgagagacaggggccgttgcgagtc
gatatgaactggcaggtttataccatattcaactctgacagtgtgcctgtggaaaataca
ccactctacggatctcatccattccacctcgggcttgaagactccggcaagagccacggc
atggtgcttctcaactccaacgctatggacatagtaacccaaccgactccagcgctaacc
tacagaactatcggaggcatcctcaacttcctgctggttctgggggacgcccccaacgac
gtgttggccgagtacacggcgctggtgggacgccccgcgatgccgccgtactgggccctg
ggcttccatttgtgcaaattcaactatggcagtctaaacgtgacacgagatgtatggcag
aaaaacagagacgctggactaccttttgacgtccaatggaacgatctcgactacatgtcc
gactcgaacgacttcacatacgacaccgagcgcttcgccggcctcccgcagttcgtgcgc
gcgctgcaccgacaacacatgcactatgtcgtgcttatcgaccctggcatcagtagttca
gaaaaacctggagagtacccgccgttcgaccgcggcctcgagctagacatcttcatcaag
aactccagcaatatgccttttgtgggaaaggtatggaacaaacagaccacagtatggccg
gacttcacccacccgagcgcgcaggcgtactggctggagatgctcaagtccctgcacgac
caggtgcccttcgacggcgcttggattgacatgaacgagccttcaaacttcctctccggt
cccatgtacggacactgcgagccggaagacctgccctacgtaccacacggcatcagagga
gatggactgaaaaccaaaaccctgtgcatggacgccaaacactatgcaggttctcactac
gactggcacaacctgtactccatcacggagtctatcgccaccaactttgcaatgaccgag
ctccgcggctcgcgtcctttcataatctcccgctccacgttcgtgggcagcgggcgccac
gccggccactggagcggcgacgtggccagcgcctggcacgacatgcgcatgtctataccc
gaaatgttagcgttctccctattcggggttccgttgatgggcgcggacatctgcgggttc
cgtggtaatactacggttgaactctgcacgcgatggatgcaactcggcgctttctacccg
ttctcgaggaaccataattcagataccagcattccgcaagacccagccagcctcggcccg
gcagtactagaagccagcatacgcatactccgtgttcgctactctctattgcctctttac
tacactctgttctggcgagccaaggacagtggcgccaccgtcgcgcgcccgctgttcgct
gaatttcccaccgacccgctaactcacgacatcgacactcagttcatgatcggccccagc
atcatgatcgcacccatcctgcagcccaacaccactagcacacaggcatacctgcctgat
gatctcccgtggctggttctgacgacggagaagaaagcgcccaataaatacgtaaccatt
catgaacacggaactgtacttgtgcggccgggctcaagcgagtcgctacaactgatagtg
ttagaactgttagaagatagtagcggcaaggcttatggcgagttgtactgggatgatgga
gatagcctgaatagctacgaggagaaaaagtacagccacatcgaattctacaagcaatcg
acttcggtcaacagtgcagtgcagtggtggggctatggagtgcccacagttaataacatt
accatctatagcatagaatacccggttaaaaccgtcgagctaaacgaccaaccatgcaag
aaaccgctgtgcgaattctcatacgatgctaaagatcatattctaagagtgtacaacatg
aacttatctttagataagccattctcgctgacttggacaaataagaatagttatcccaag
cttattgtacccaatggcggtggtcatcttgccatggtcaatgagaccgtcgtagactgc
agatatgctgattgtactgaaattaaaaagcgatga

DBGET integrated database retrieval system