KEGG   Plutella xylostella (diamondback moth): 105386177
Entry
105386177         CDS       T03915                                 

Definition
(RefSeq) uncharacterized LOC105386177
  KO
K20017  Bcl-2 family protein
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy04214  Apoptosis - fly
pxy04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105386177
   04215 Apoptosis - multiple species
    105386177
SSDB
Motif
Pfam: Bcl-2 HOK_GEF
Other DBs
NCBI-GeneID: 105386177
NCBI-ProteinID: XP_011554986
LinkDB
Position
Un
AA seq 325 aa
MEYSKVDGCNNIAIHVIPPDGEEDDEFSAPAQEAPRVRLRRKLSSPLSALPADNLLAINN
VRRSAGRSLSALDRTTRRFSTMVSSAAAAAVSRRLSATIGWCLASPTQVKPHIVRQGRAL
CLQYIKSQIRRSTITTKKLVMKRLQRMIETECGEDAVSNVESGALAALRMLCCALERKRP
DAFRHVARQATRAPAAMLRSDTALAELALALARRITNDNITWSKMAAVFCVCGALAREAA
EAAGGEPSTELVAAPAAALADLLHEEPGGWVAAHGGWNGLIERLRASERDQRSERTLRVM
ISVFVIICLTLLLLRWVIHAHPSYY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggagtattcaaaggtggacgggtgcaacaacatcgccatacacgtcattccacccgat
ggcgaagaagatgacgagttctctgcgccggcgcaggaggcgccgcgggtgcgcctgcgc
aggaagctgagctccccgctgagcgcgctgcccgccgacaacctgctcgccatcaacaac
gtgcgtcggtcggcgggtcgctcgttgtcggcgctggaccgcacgacgcggcgcttcagc
accatggtgtcgtcggccgccgccgccgccgtgtcgcgccgcctctccgccaccatcggc
tggtgcctcgcctcgcccacgcaggtcaagccgcacatcgtgaggcagggccgcgcgctc
tgcctccagtacatcaagtcgcagatacgacgctccaccattactactaagaaactggta
atgaagcgtctgcagcgcatgatcgagacggagtgcggcgaggacgcggtgagcaacgtg
gagtcgggcgcgctggcggcgctgcgcatgctgtgctgtgcgctggagcgcaagcggccg
gacgcgttccgccacgtggcgcgccaggccacgcgcgcgcccgccgccatgctgcgctcc
gacaccgcgctggccgagctggcgctggcgctcgcacgccggatcaccaacgacaatatc
acctggtctaaaatggcagcagtattctgcgtgtgcggcgcgctggcgcgggaggccgcc
gaggccgccggtggggagccctccacggagctggtggcggcgccggcggccgcgctggcc
gacctgctgcacgaggagcccggcggctgggtcgccgcgcacggcggatggaacgggctg
atcgagcgtctgcgcgcgagcgagcgcgaccaacgctcggagcgaaccctgcgcgtcatg
atctccgtgttcgtgatcatctgcctgacgctgctgctgctgcgctgggtcatccacgct
cacccctcctattactga

DBGET integrated database retrieval system