KEGG   Plutella xylostella (diamondback moth): 105386722Help
Entry
105386722         CDS       T03915                                 

Definition
(RefSeq) trypsin, alkaline B-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105386722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pxy01002]
    105386722
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxy04147]
    105386722
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     105386722
Peptidases [BR:pxy01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105386722
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105386722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 105386722
NCBI-ProteinID: XP_011555642
LinkDB All DBs
Position
Un
AA seq 193 aa AA seqDB search
GHFAFTFRVRLGSSTPGSGKNFNVEDFKTHERFDSPRQANDIALMFLSTRASPSNTIGFA
RIPGLSYTVADNTSVVAVGYGDLRENGDNPEMLQSVELFTVNQEYCSEQYAYLKTQPDRE
DTPIVSEDMLCVGLTGIGGKGFCKGDEGGPIVIEKDIVVGVASWRYRCGDPIYPGVATRV
GSYADWIVANGGV
NT seq 583 nt NT seq  +upstreamnt  +downstreamnt
gggtcacttcgcgttcacgttccgtgtgcgcctgggcagctccacgcccggctctggcaa
gaacttcaacgtggaagacttcaagacgcacgagcggttcgactcgcctcgccaggccaa
cgacatcgccctgatgttcctctcgaccagggcttctccgtctaacaccatcggctttgc
gcgcatccctggtctgtcgtacaccgtcgctgacaacaccagcgttgtggctgttggata
cggcgatctgagggaaaacggagataaccctgagatgcttcaaagcgttgagctgttcac
cgtaaaccaggaatactgctctgagcagtacgcctacctgaagacccagcctgaccgcga
agacacgcctattgtctccgaagacatgctctgcgtcggactgacgggtatcggtggcaa
gggcttctgcaagggcgatgaaggtggaccaatcgtcattgagaaagacattgtagtggg
cgtggcctcatggaggtacaggtgtggagaccccatctaccctggcgttgccactcgagt
ggggagctacgcagactggattgtagctaacggtggtgtctaa

DBGET integrated database retrieval system