KEGG   Plutella xylostella (diamondback moth): 105387232
Entry
105387232         CDS       T03915                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00230  Purine metabolism
pxy01100  Metabolic pathways
pxy04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105387232
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105387232
Enzymes [BR:pxy01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105387232
SSDB
Motif
Pfam: Guanylate_cyc AC_N CRIM DUF2642
Other DBs
NCBI-GeneID: 105387232
NCBI-ProteinID: XP_011556231
LinkDB
Position
Un
AA seq 997 aa
METLRTVRDWWLVAPPWGFAAERDERLYSMYTSRQRQRAVPRVLACGVLMHVWELLVPGT
RDVPGAAASSLLELALVLVLLASHAAVGMGRRLVAHVAWLLLWMQVLSAAVVRAGDSYNE
MLGWAVLLQYLTLAALPFHFMVLITYSVITLIGFVLCQYYNACRKGRLPEDFAYQEAANF
TLLLGASLLGATAYAVAERQQRCSFQETKRSLGDKLTIEQQSKEQERLLLSVLPEHVAVQ
MRKDLGLIDTQFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVAILNELFARFDRLA
EKYQQLRIKILGDCYYCISGAPVERPDHAVLCVHMGLSMVKAIKYVQQTTNSPVDMRVGI
HTGAVLAGVLGQRQWQFDVYSRDVELANKMESSGKAGRVHVSEVTLGYLNDDFEVEPAHG
ERREEMLRQAGIKTYFIVRVLKPFQSGEERGAVEAAAAAGAGGAGGEGDAPDTLSDLRDD
DEDSVLSPQEESVDDSEELKILEMLEEELVNRDDDKELADATTFCLTFRSEEAEAAWTRR
RDACPQAGVAPPLLLLPPVAVLAGFAVPPAQALHALYLALVLETGLINVIYYVCYRYAAY
KKKTISPYWKLTCGLFNIGMFIAANITPLIICGNYEAVLDDGLAEGSLPHAGARRCLHPS
YYYQVGAGIACGALWVSPLGGLARAALLLGLAGAHALPALLYPVLLRPRIDLDRDPYLSI
NQSAVDYDFIVNVVHFMGAKHHHRDLYSQSYAEVGVLFASMPNFSEFYSEETVNNQGLEC
LRFLNEVISDFDLLLEEAKFKDIIKIKTISSTYMAASGLNPTRQMQPSDSVVVRWAHLAC
LVEFALELQRVLAAINEQSFNHFVLRMGVNHGPITAGVIGARKPHYDIWGNTVNVASRME
STGKAGCIQVTEETCGILQSFGYYFEQRGLVAVKGKGQLMTYYLQGKRDAAVVTTTPEDD
PAAMINTHEDGSSEALLANGAAPAPAPAPDSLLASTD
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggagacgctgcggacggtgcgggactggtggctggtggcgccgccgtggggcttcgcg
gcggagcgggacgagcgcctgtactccatgtacacctcgcggcagcggcagcgcgccgtg
ccgcgcgtgctggcgtgcggcgtgctcatgcacgtgtgggagctgctggtgccgggcacg
cgcgacgtgccgggtgcggccgccagctcgctgctggagctggcgctggtgctggtgctg
ctggcgtcgcacgcggccgtgggcatgggccgccggctcgtggcgcacgtggcctggctg
ctgctgtggatgcaggtgctgtcggcggccgtggtccgcgcgggcgactcctacaacgag
atgctgggctgggccgtgctgctgcagtacctcacgctggccgcgctgcccttccacttc
atggtgctcatcacctacagcgtcatcactttgattggattcgtcttgtgccagtactat
aatgcgtgcagaaaaggaagattacccgaagattttgcttaccaggaggcagcaaacttc
acccttctcctgggggcgtctctcctgggggcgacggcctacgcggtggcggagcgccag
cagcgctgctcgttccaggagaccaagcgcagcctcggggacaagctcaccatcgagcag
cagagcaaagagcaggagcggttgttactgtctgtgctaccggagcatgttgcagtccag
atgcggaaggacctgggcctcatcgacacgcagttcaagaagatctacatgtcccggcat
gagaatgtcagtattctgtacgccgacatcgtcgggttcacggcgatctcgtcgacgtac
tcggcgcaggacctggtggccatcttgaacgagctcttcgcgcgcttcgaccgcctggcc
gagaaataccagcagctacggataaagattctcggcgattgttactactgcatcagcggg
gctccggtcgagcggcccgatcacgccgtgctctgtgtccacatgggcttgtccatggtc
aaggctataaaatacgtgcagcagacaaccaactcgccggtggacatgcgcgtgggcatc
cacacgggcgcggtgctggcgggcgtgctgggccagcgccagtggcagttcgacgtgtac
tcgcgcgacgtcgagctggccaacaagatggagagcagcgggaaggccggacgagtccac
gtctcggaagtgaccctgggctacctgaacgacgacttcgaggtggagccggcgcacggc
gagcggcgcgaggagatgctgcgccaggccggcatcaagacctacttcatcgtccgcgtg
ctcaaaccttttcagagtggcgaggagaggggcgcggtggaggcggctgcggcggcgggg
gcggggggcgcggggggcgagggggacgcgcccgacaccctgtccgacctccgcgacgac
gacgaggactcggttctatcaccgcaagaggagtcggtggacgatagcgaagagctgaaa
atacttgagatgttagaggaggagttggtcaaccgcgatgacgacaaggagctggctgat
gcgaccacgttctgcctcaccttccgctccgaggaggccgaggccgcctggacgcggcgc
cgcgacgcctgcccgcaggcgggtgtggcgccgccgctgctgctgctgccgcccgtggcc
gtgctggcggggttcgccgtgccgcccgcgcaggcgctgcacgcgctgtacctcgcgcta
gtgctggagaccggcctcatcaacgtcatctactacgtgtgctaccgatatgctgcttat
aagaaaaagacaataagcccgtactggaaattgacgtgtgggttgttcaatattggcatg
ttcatcgcggctaacattactccgctgataatctgcggcaactacgaggcggtgctggac
gacgggctggcggaggggtctctgccgcacgccggcgcgcgccgctgtctgcacccctcc
tactactaccaggtgggcgccggcatagcctgcggcgcactatgggtctctccgctgggc
gggctggcgcgcgccgccctactactcgggctggcgggggcgcacgcgctgcccgcgctg
ctgtaccccgtgttgctgcgcccgcgcatcgacctcgaccgcgacccctacctgtcgatc
aaccagtcggctgtcgactacgacttcatcgtgaatgttgtccacttcatgggcgccaag
caccaccaccgcgacctctacagccagagctatgctgaagtcggagtgctgttcgccagc
atgcctaacttctctgagttctattcagaagagaccgtcaacaaccaaggactcgagtgt
ctgaggttcctcaatgaagtcatatccgatttcgatttgctgttggaagaagccaaattc
aaggatataataaagatcaagactatcagctccacgtacatggctgcgtcaggcctaaac
ccgacgagacagatgcagccatcagacagcgtggtggtccgctgggcgcacctggcgtgc
ctggtggagttcgcgctggaactacagcgcgtgctggcggccatcaacgagcagtccttc
aaccacttcgtgctgcgtatgggcgtcaaccacggaccaatcacggccggcgtcatcggc
gccaggaagccccactatgatatctgggggaacacggttaacgtggcctcgaggatggag
agcactggcaaagctgggtgtatacaggtgacagaagaaacgtgcggcatcctacagagc
ttcggctactacttcgagcagcgcgggctggtggcggtgaagggcaaggggcagctcatg
acgtactacctgcagggcaagcgcgacgccgccgtcgtcaccaccacgcccgaggacgac
ccggcggcgatgataaatactcatgaagacgggtcgagcgaagccctcctggccaacggc
gccgccccggcccccgcccccgccccggacagcctgctggcttcaacggactaa

DBGET integrated database retrieval system