KEGG   Plutella xylostella (diamondback moth): 105390215Help
Entry
105390215         CDS       T03915                                 

Definition
(RefSeq) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00330  Arginine and proline metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    105390215
Enzymes [BR:pxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     105390215
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   105390215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 105390215
NCBI-ProteinID: NP_001292442
UniProt: D9YT56
LinkDB All DBs
Position
Un
AA seq 355 aa AA seqDB search
MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLLDCIQSGVENL
DSGVGIYAPDAEAYSVFADLFDPIIEDYHTGFKKTDTHPPKNWGDVETLGNLDAAGEFIV
STRVRCGRSMEGYPFNPCLTEAQYKEMEEKVAATLSGLEGELKGTFYPLTGMSKETQQKL
IDDHFLFKEGDRFLQAANACRFWPSGRGIFHNENKTFLVWCNEEDHLRLISMQMGGDLKA
VYARLVAAVNDIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKTKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgctgcaactcttgagaaattggaggctggcttcagcaagctggccgcctct
gactccaagtcactgctgaagaagtacctgaccagggaagtgttcgacgctctcaagaac
aagaagacttccttcggctccacccttttagactgcattcagtcaggtgtggagaacttg
gactctggtgttggaatctacgcccctgacgccgaggcgtacagtgtgttcgctgacctg
ttcgaccccatcatcgaggactaccacaccggcttcaagaagactgacacccaccccccc
aagaactggggtgatgttgagaccctcggaaacttggacgccgctggcgagttcattgtc
tccacccgtgtgcgttgtggacgttccatggagggctaccccttcaacccctgcctgacc
gaggcccagtacaaggagatggaggagaaggtcgccgccaccctgtccggactcgaggga
gagctgaagggtaccttctaccccctcaccggcatgtccaaggagacccagcagaagctg
attgacgaccacttcctgttcaaggagggagaccgtttcctgcaggccgccaacgcttgc
cgcttctggccctctggacgtggtatcttccacaacgagaacaagaccttcctggtgtgg
tgcaacgaggaggaccacctccgcctgatctccatgcagatgggtggtgacctgaaggcc
gtgtacgccaggctggtggccgccgtcaacgacattgagaagcgcgtgccattctcgcac
cacgaccgtctcggtttcctgaccttctgccccaccaacctgggcaccaccgtgcgcgcc
tccgtgcacatcaagctgcccaagctggccgccgacaagaccaagctggaggaggtggcg
tccaagtaccacctgcaggtgcgcggcacccgcggcgagcacacggaggccgagggcggc
gtgtacgacatctccaacaagcgccgcatggggctcaccgagtacgacgccgtcaaggag
atgtacgacggcatcgccgagctcatcaagatcgagaagtccctgtaa

DBGET integrated database retrieval system