KEGG   Plutella xylostella (diamondback moth): 105392295Help
Entry
105392295         CDS       T03915                                 

Definition
(RefSeq) aminoacylase-1A-like
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00220  Arginine biosynthesis
pxy01100  Metabolic pathways
pxy01210  2-Oxocarboxylic acid metabolism
pxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    105392295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pxy01002]
    105392295
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxy04147]
    105392295
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     105392295
Peptidases [BR:pxy01002]
 Metallo Peptidases
  Family M20
   105392295
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105392295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 105392295
NCBI-ProteinID: XP_011562200
LinkDB All DBs
Position
Un
AA seq 444 aa AA seqDB search
MTKIWSLVSCHILIIFLNTSASCASVDYSSDPYVQLFQQYLRINTTTTISDLTPAVQFWQ
DLASSLDLELQKHVYVPGYPVLVIKWPGVDPSLPSVVLNSHMDVVPVNEAEWKYPPFAAT
LDSDGVIWGRGTQDMKSVSIQYFLAMKELKQNNVTLLRDVYMTLMPDEEVGSVSGLRLFK
ESPEFAALNVGCVMDEGAAAPLPVYGMFYQDKAIWQIEVTCYGEAGHSATFPASNTTATG
KCRYVIDKFLSYRDQQHAISETATLLKSGLFTAINLNKIRAGTANNVVPQSVSLVFDIRL
ATELNTTAFELQMNSWLAEAGSGINMTFLQKNKQSARTVVSKKNPYYAAIQSAASNLGIT
IVPIVSPGSTDARHLRLQDVPAFGFSPLANTPTLLHTDNERLNVTTFLNGIGIYKEIITS
LANIPASKTNKLDVQSLVVQSEFN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatatggagtttggtttcgtgccatattttgataattttcctaaatactagt
gcatcttgtgctagcgtagactatagtagcgatccatacgtgcagttgtttcaacaatat
ctcagaatcaacactaccaccacgataagtgatctcacgccagcggtccaattctggcaa
gacctagcctcatccctggacctggagctccagaagcatgtgtatgtgcccggctacccc
gtgctcgtcatcaagtggcccggagtagacccctcgctgcccagcgtcgtgctcaactcg
catatggacgtcgtgccggttaatgaggctgaatggaagtaccctccattcgcggcaacc
ctggactcagacggagtgatctggggccgaggcactcaggacatgaagagtgtttccatc
cagtacttcctggctatgaaggaactgaaacagaacaatgtcactctgcttcgggatgtc
tatatgactttgatgcccgacgaggaggtgggcagtgtctccgggctgcgtctcttcaag
gagtcccctgagttcgcggcgctgaacgtgggctgcgtgatggacgagggcgccgccgcg
ccgctgccggtttatgggatgttctaccaggataaggctatttggcaaattgaagtgaca
tgttacggagaagcaggacacagcgccacattcccagcctctaacacaaccgccacgggg
aagtgtcgctacgtgatcgacaaattcctgagctaccgcgaccagcagcacgcgatctct
gagactgccacgctgctgaagtctggcctgtttactgccatcaatctgaacaaaatacgg
gcgggcacagccaacaacgtggtgcctcagtctgtgagcctggtgttcgacatccgcctt
gccactgaactcaacaccaccgccttcgaattgcagatgaactcctggctagcagaggcc
gggtcaggcatcaacatgaccttcctacagaagaacaagcagtcagcgcgcactgtcgtc
agcaagaagaacccctactacgcggctatacagtccgctgccagcaacttgggcatcaca
atagtgccgatagtgtctccaggctccactgacgcgcgccacctacgcctgcaagacgtg
ccagcattcgggttctctccactagcgaacacccccacactgctacacacagacaacgag
aggctaaacgtcaccacgtttctgaacggaatcgggatttacaaggaaattatcacatcc
ctagctaatattcccgcttcgaagacgaataaactggatgtgcagtctttggtcgttcag
tctgagtttaactaa

DBGET integrated database retrieval system