KEGG   Plutella xylostella (diamondback moth): 105392770Help
Entry
105392770         CDS       T03915                                 

Definition
(RefSeq) 46 kDa FK506-binding nuclear protein
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pxy03009]
    105392770
Enzymes [BR:pxy01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105392770
Ribosome biogenesis [BR:pxy03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    105392770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 105392770
NCBI-ProteinID: XP_011562751
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MFWGLIMEPNKRYTQVVEKPFHISQAALDISTGDNEACQVMVVVESKNFLVATLQKTKQI
QVPLDLYFKAGDAISFLTNGKSNVHLTGYLDPEFEDMSGDEEEEEEDEEEAPELVPVNTK
NKRKLETSNDAAAKKPKQDKKAAKKAPAADDSDASDDDDDDQLAKFLDGEDVDTDENDES
FKVNTSADDSDEEDSDEEEEDDDDSDEEAPQQNGDAESSDEAEAETTVDSTLETDIDTSK
LSKSAKRRLKKKLAQEKAAGAQVNGKAKKADEKAPQQKAEKKEQQQKAKKEIETADKKEK
KALSGGVAIEDLKVGNGPVAKPGKVVQVYYEGRLKSNNKMFDNCLKGPGFKFRLGSKEVI
SGWDIGVAGMKVGGKRKIVCPPAMAYGAKGSPPVIPPNSTLVFEVELKNVK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttttggggactaataatggaacccaacaagcggtacacccaagtggtggagaagccg
ttccacatctcccaggctgcgctggacatctccaccggagataatgaggcctgccaggtc
atggtggttgtggagtccaagaacttcctagtggccacgctgcagaagaccaagcagatc
caggttcccctcgacctgtacttcaaggcaggagacgctatttcattcttgacaaatggt
aagagcaatgtccacttaacgggatacttggacccggagtttgaggacatgtccggtgac
gaggaggaggaggaagaagatgaggaggaggccccggagctggtccccgtcaacaccaag
aacaagaggaaactggagaccagcaatgatgcggcggctaagaagcccaagcaagacaag
aaggcagctaagaaggcaccagcagctgatgacagtgacgcctccgacgatgatgatgat
gaccagctggccaagttcctggatggagaggatgtggacactgacgagaatgatgagtct
ttcaaagtgaacacctcagccgatgacagtgatgaggaagattcagatgaagaagaggaa
gacgatgatgactccgacgaggaggctccacagcagaatggcgacgccgagtcatccgac
gaggccgaggctgagaccacagtagatagcacgctggagacagacattgacacatccaag
ctcagtaagagcgcaaaacgacgactgaagaagaaactcgcacaagagaaggcggcggga
gcccaagtcaatggcaaagctaagaaggccgatgagaaggctcctcagcaaaaggcagag
aagaaggagcagcaacagaaagccaaaaaggaaatagagaccgcggacaagaaagagaag
aaggcactcagcggaggcgtcgccattgaggacttgaaagtcggaaacggtccagtagca
aagcccggcaaagttgtacaggtatactacgagggtcgcctgaagtcgaataacaagatg
ttcgacaactgcctgaaggggcccgggttcaagttccggctggggtccaaggaggtgatc
tccgggtgggacatcggcgtcgccggcatgaaagtgggaggcaagaggaaaatcgtgtgc
ccacccgccatggcatatggtgctaaaggctccccaccagtgatcccccccaactcgacg
ctagtcttcgaagtggaactgaagaacgtgaagtaa

DBGET integrated database retrieval system