KEGG   Plutella xylostella (diamondback moth): 105393364
Entry
105393364         CDS       T03915                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pxy01002]
    105393364
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pxy03110]
    105393364
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     105393364
Peptidases and inhibitors [BR:pxy01002]
 Serine peptidases
  Family S8: subtilisin family
   105393364
Chaperones and folding catalysts [BR:pxy03110]
 Intramolecular chaperones
  Subtilisin family
   105393364
SSDB
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Other DBs
NCBI-GeneID: 105393364
NCBI-ProteinID: XP_011563409
LinkDB
Position
Un
AA seq 1259 aa
MADVPIDCDFPVWGLMPKKETGVVSFLNKNPNYDGRGTVIAILDSGVDPAADGLKLTSTG
ETKVIERFDCSGCGDVDTSTVITKVVDGCITGLTGRQLTIPESWKNPSGEWRLGVLYPYS
LYPGKLKERVQEHRKTHQWDVGHKPAFAAANKALQDFETENASSPGPLSPELKLQREELE
ARVEALQAANRKHSDVGPACDAVLFHDGAVWRACIDTSESGDLSSGPLLGEYSVTHEHTH
LTPLDEMTVSINVHNEGNVLEVVGMCSTHGTHVAAISAGYFPEEPDRNGVAPGAKIISLT
IGDSRLGSMETGTALVRACIKLMQLSKEQTVHVVNMSYGEHAHWSNAGRVGSLICEVVAR
YGVCWVVSAGNHGPALCTVGAPPDVHQATLIGVGAYVSPEMMSAAYSMRARSGGGLFSWS
SRGPCADGAAGVSVCAPGAAVAPVARFTLRNSQLMNGTSMAAPHVAGATAALISGLKAKG
LKYSPFSVKRALENSATYLSHVEPWAQGCGLLNIEKAFDILTTHHDAPERDVTFTIECGA
SRGKGVLLRPRQGDTHTDVAVSIEPAFLHHCSDTDDLQTLRAQISFGLRLTLANSAPWIS
APTHLDMMNANRPISIRVDTAALPPGPHFSSIDAYDVNCIEKGPVFRIPVTVFQPEPLDP
STPVISCDAEFRPSSIRRHLLVPPPGTTWGVLRISSRDQNTQGRYLVHTMQMLPQSSCRS
HETQKMLSVSTDAPAALPFRVVEGVTLEIAIAKYWANMGSHRISYTIELFGLKPSCGRRA
VALGAGGLSRLLLAAHRQQDCQPHAQLKHAELPQRPTESKITPLTSRDIVPPNRQIYQLV
NTYTFHLAKGTEVTPIVSLLSDMLYESEFESQMWMLYNSCKQLMAVGDAYPSKYSVKLDK
GDYTLRLNVRHESKQVLELIAELAVLLQQRLPQPLTADLYCTRHEALTAPGPPGGPLPLY
LSSIPSDKISRSNLTVGQTLTGTITFTKDELGRKVDTYELVYVVPEPPKRNNNNNKEKEK
GNPYEEYLNAMKDFKTNWMVKLEGDKLEQVYEEVQELFPGYLGAHVAYLHAVDSSTDAAK
LPHAEQAPDVTTAWCEQLITISDKVIKAIDQDKLLAYLGIKNDTRSDANKIKVEQEKQRG
YLIDALCRKGTALCRLLALADSAAAKEKLMTSLKDNMADLLKFTDLTDAKAIHYGVWHCF
AHKHWGRAIKLLTKIQEDKPSKEVEERLLEAYKQLQWDHLVKYTTSAMPTKYPTTYRPF
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggcagacgtccccatcgactgtgattttcccgtctggggattaatgccgaaaaaagaa
acaggagtggtctctttcttgaataaaaacccaaactacgatggaagaggcaccgtcatt
gcaattctggactctggagtcgatccggctgccgacgggctcaagttgacgagcacaggg
gagacgaaggtgatcgagaggttcgactgcagcggttgcggcgatgtggacaccagcacg
gttatcactaaagttgttgacggctgcattaccggtctcactggtcgccagctgacgatt
ccagagtcatggaagaacccgagtggagagtggcgcctgggagtgctgtacccgtacagc
ctgtaccccggcaagctcaaggagcgcgttcaggagcaccgtaagacgcaccagtgggat
gtcgggcacaagcccgcctttgccgcagctaacaaagcactgcaggactttgagactgaa
aatgcctcgtcccctggaccgctgtccccggagctcaagctgcagcgcgaggagctggag
gcgcgcgtggaggcgctgcaggccgccaacaggaagcacagcgacgtggggcccgcgtgc
gacgcggtgctgttccatgatggggcggtgtggagagcctgcatagacacatcagagtcc
ggcgacttatcctccgggccgctactgggtgaatacagcgtgactcacgagcacactcac
ttgacgccgctcgacgagatgaccgtcagcatcaacgtgcacaatgaggggaatgtgctg
gaggttgtggggatgtgctcgacacacggcacgcacgtggcggcgatctccgcggggtac
ttccccgaggagcctgacagaaacggagtcgcacccggagccaagatcatctcgctcact
ataggagacagtcgcctaggctccatggagacgggcactgcgctagtgcgggcctgcatc
aagctgatgcagctcagcaaggagcagacagtgcacgtggtcaacatgagctacggagaa
cacgcacactggagcaacgcgggtcgcgtcggctcactaatctgcgaggtggtagcgcgc
tacggcgtgtgctgggtggtgtccgccgggaaccacgggcccgcgctgtgcaccgtggga
gcccctccggacgtgcaccaggctacgcttataggtgtaggcgcctacgtgtcccccgag
atgatgtcagcggcctactccatgcgcgcgcgctccggcggcggcctgttctcctggtcc
tctcgggggccgtgcgcggacggggccgcgggggtcagcgtgtgcgcccccggggccgcc
gtggcgcccgtcgccaggttcaccctgcgtaactcgcagctgatgaacgggacatcgatg
gctgctccccatgtggctggcgctacagcggcgctaatatctggtctaaaggcaaagggc
ctcaaatactctccattctccgtaaaacgagcgttggagaactctgccacttacttgagc
catgtggagccgtgggcgcagggctgcgggctgcttaatatagagaaggcattcgacatc
ctaacaacgcaccacgacgcccccgagcgtgacgtcacattcaccatcgagtgcggcgcc
tcgcgaggcaagggcgtgctgctgaggccgaggcaaggagacacgcacacagacgtggcc
gtgagcatcgagcccgccttcctgcaccactgtagcgatactgacgacctccaaaccctg
cgtgctcagatctccttcggtttacgcctgaccctcgccaactctgcgccgtggatatcg
gcccccacgcacctggacatgatgaacgctaacaggcctatctccatacgggtggacacg
gccgcgctgccgccggggccgcacttctctagcatagacgcctacgacgttaactgcata
gaaaagggcccggtattccggatcccagtgaccgtgttccaaccggagcccctcgatccc
tcaaccccggtcatcagctgtgacgccgagttccgtccgtccagcatacggagacacctg
ctggtgccgccgccgggcaccacgtggggcgtgctgaggatcagctccagggatcagaat
acgcagggcagatacctggtgcacacgatgcaaatgctgccccagtccagttgccgctcg
catgagacgcaaaagatgctgagcgtgtccacggacgcgcccgccgcgctgcctttcaga
gttgtggaaggcgtaaccctcgagatagccatcgccaagtactgggcgaacatgggctcg
caccgcatcagctacaccatcgaattattcggtctcaaaccctcgtgcgggcggcgcgcg
gtggcgctgggcgcgggcgggctcagccgcctgctgctcgccgcgcaccggcagcaggac
tgccagccgcacgcgcagctcaagcacgcggagctgccccagaggcctacagagtcgaag
ataaccccgctaacatccagggatattgtgcctccgaaccgacagatctaccaactcgtc
aacacttacaccttccacttagctaaaggaactgaggtgactccgatagtgtctcttcta
tccgacatgctgtacgagtcggagttcgagtcccagatgtggatgttgtacaacagctgc
aagcaactcatggccgtcggcgacgcctaccctagcaagtactccgtgaaactagacaaa
ggcgactacacactccgtctgaacgtgcggcacgagagcaagcaggtgctggagctgatc
gcggagctggccgtgctgctgcagcagagactgccgcagccgctcaccgccgacctgtac
tgcacccggcacgaggcgttgactgccccggggccgccgggggggcccctgccgctctac
ctgagctctataccgtctgacaaaataagccgctccaacctgaccgtcgggcaaacccta
acaggcacaattaccttcactaaggacgaactaggtcgcaaggtggacacatacgagctg
gtgtatgtagtaccggaaccgcccaagaggaataataataataacaaggagaaggagaag
ggcaacccgtacgaggagtatctgaacgcgatgaaggacttcaagactaactggatggtg
aaacttgaaggcgacaagttggaacaagtatatgaagaagtgcaggagctgttccccggc
tacctcggcgcgcacgtcgcgtacctacacgccgtggactcttctactgacgccgccaaa
ctacctcacgcggagcaggcgccggacgtgacgacggcgtggtgcgaacaactcatcact
atttctgataaggttataaaggcaatagatcaagacaagctgctggcgtatctaggaatc
aagaatgacacgcgtagtgacgctaataaaatcaaagtagaacaagagaagcaacgcggc
tacctcatagacgcgctgtgtcggaaggggacggcgttatgtcgcctgctcgctctcgcc
gacagcgccgcggcgaaggagaaactgatgacgtcactcaaggacaacatggccgacttg
ctcaagttcactgacctcactgatgctaaggcaatccactacggcgtgtggcactgcttc
gcccacaaacactggggccgcgccatcaaactcctcaccaagatacaagaagacaaaccc
tcgaaggaggttgaagagcgactgctagaggcctacaaacaactgcagtgggaccactta
gtgaaatataccactagtgcgatgccgaccaagtatccaaccacctataggccgttctag

DBGET integrated database retrieval system