KEGG   Plutella xylostella (diamondback moth): 105393992Help
Entry
105393992         CDS       T03915                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00480  Glutathione metabolism
pxy00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105393992
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105393992
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105393992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 105393992
NCBI-ProteinID: XP_011564128
LinkDB All DBs
Position
Un
AA seq 276 aa AA seqDB search
MRLLVTSLKPVRSVGQVLNKTEAQYRTMSTRGIKFNTKHLRKGDPLPPYNGKLRLYNMRY
CPFAQRTVLALNAKDIDYEVVNINLFEKPEWLTSKSAFGKVPSLEIKEGLSIYESLVTVE
YLDEVYPQRPLLPKDPVQRALDKIIVEACTPIQGLFIKLIKFPESISEDTVAAYHKALHF
LQEQLQSRGTRFFGGDQPGFVDYMIWPWFERXLPYQRVESRVQIDAGKFKLLLEYLQNLK
QDPVVKQYLIEDEVLFKFLEPYKTGGEPNYDLLLEA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgttagtaacatcactcaaaccggtaagatcggttggacaagtgttaaataag
actgaagctcagtatagaaccatgtctacaagaggaatcaagtttaatacgaaacacctt
aggaagggcgacccactgccgccgtacaatggcaagctgcgtctgtacaacatgcggtac
tgccctttcgcgcagcgcaccgtgctcgctctgaatgctaaagacatcgactatgaggtc
gtcaacatcaacctgttcgagaaaccagagtggctcaccagcaagagcgctttcggcaaa
gtgccatccctagagatcaaggaaggtctgtcgatctacgagagtttggtcacagtggag
tacctcgacgaggtctatccgcagagacccttgctgcccaaggaccctgtgcaacgagct
ttagacaaaatcattgttgaagcgtgcactccgatccaaggtttattcataaagctgatc
aagttccccgagtcgatctcagaggacacggtcgcggcgtaccacaaggcactgcacttc
ttgcaagaacaacttcagtcccgcggcacaaggttcttcggaggggaccagcctgggttc
gtggactacatgatctggccgtggttcgagcggntgctgccttatcagagggtggagtcg
agagtccagatcgatgcgggcaagtttaagttattgttggagtatttgcagaatttgaag
caagatcctgttgtgaagcaatatctgattgaagacgaagttttgttcaaattcctggaa
ccatacaagactggtggcgaacctaactacgacttattgctggaagcctag

DBGET integrated database retrieval system