KEGG   Plutella xylostella (diamondback moth): 105394770Help
Entry
105394770         CDS       T03915                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy04213  Longevity regulating pathway - multiple species
pxy04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    105394770
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105394770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pxy03036]
    105394770
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105394770
Chromosome and associated proteins [BR:pxy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     105394770
   HDAC complexes
    Sin3A-HDAC complex
     105394770
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105394770
  Chromatin remodeling factors
   NuRD complex
    105394770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 105394770
NCBI-ProteinID: XP_011564984
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MAMQPHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
ADEMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYVDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDSYESI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGRCVELVKRFGLPFLLVGG
GGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTPEYLD
KIKNRLFENLRMLPHAPGVQVQAIPEDAVNDESDDEDKIDKDERLPQIEKDKRITGDGEL
SDSEDEGSGGRRDNRSYRSVQPRKRPRLDKDGAPVKDELKAEDVKDEVKNASAAEEPKKE
APTNP
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaaccacacagcaagaaaagagtgtgctattattacgatagtgacattggc
aactactactatgggcagggacacccgatgaagcctcaccgcatacgtatgacgcacaac
ctcctgctcaactatggattatacagaaaaatggaaatttaccgaccacacaaagccact
gctgacgagatgacaaagttccactcggacgactacatccgcttcctgcgctccatcaga
ccagacaacatgtccgagtacaacaaacaaatgcaaagatttaacgtgggtgaagattgt
ccagtgttcgatggtctctacgagttctgtcaactatcagctggaggctctgtggccgcc
gcagtgaagcttaacaaacaggcatcagagatctgcatcaactggggcggcggcctccac
cacgccaagaagtccgaagcgtcgggcttctgctacgtgaacgacatcgtgctcgggatc
ctggagctgctgaagtaccaccagcgcgtgttgtacgtggacatcgacgtgcaccacggc
gacggcgtcgaggaggccttctacaccacggatagggtgatgaccgtgtccttccataag
tacggggagtacttcccgggaacaggcgacctgcgcgacatcggcgcgggcaagggcaag
tactacgcggtgaatatcccgctacgggacggcatggacgacgactcctacgagtccatc
ttcgtgcccatcatcagcaaggtcatggagaccttccagcccagcgccgtcgtgctgcag
tgcggcgccgactcgctcacaggcgaccgactggggtgcttcaacctgacggtgcgcggg
cacgggcgctgcgtggagctcgtcaagcggttcggcctgcccttcctgctcgtcggcggt
ggcggctacacaatccgcaacgtgtcccgctgttggacgtacgagacgtcggtggcgctg
ggcgtggagatcgccaacgagctgccctacaacgactacttcgagtacttcggtcccgac
ttcaagctgcacatctcacccagtaacatgtccaaccagaatacgccggagtatttggat
aagatcaagaatagactgttcgagaacctgaggatgttgccgcacgcacctggcgttcag
gtgcaagccattcctgaagacgccgtcaacgacgagtcagatgatgaagataaaatcgac
aaggacgaaaggctgccacagatcgagaaggacaagcgcatcacgggcgacggcgagctg
tcggactcggaggacgagggctcgggcgggcgccgcgacaaccgctcctaccgcagcgtg
cagccgcgcaagcgaccgcggctcgacaaggacggcgcgcccgtcaaggacgagctcaag
gctgaagacgtgaaagacgaagtgaagaacgcgagcgcagcggaggagccaaagaaggaa
gcgccgacaaatccctga

DBGET integrated database retrieval system