KEGG   Plutella xylostella (diamondback moth): 105395859Help
Entry
105395859         CDS       T03915                                 

Definition
(RefSeq) tyrosine-protein kinase Abl-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxy01001]
    105395859
Enzymes [BR:pxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     105395859
Protein kinases [BR:pxy01001]
 Non-receptor tyrosine kinases
  ABL family
   105395859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase APH SH3_3
Motif
Other DBs
NCBI-GeneID: 105395859
NCBI-ProteinID: XP_011566136
LinkDB All DBs
Position
Un
AA seq 673 aa AA seqDB search
MGAQQAKERGAAGGASMRSARSKPRVPKDPRLLGSNIFTEHSEALLQSRPLPHIPDLPAE
SAVGDAAAVVSTPLTLDTANRWTSKENLLAHVEDEDPQLFVALYDFQAAGDNQLTLKKGE
QVRIVSYNKSGEWCEAHRLAGGVGWVPSNYVTPVNSLEKHSWYHGPIARNAAEYLLSSGI
NGSFLVRESESSPGQRSISLRYEGRVYHYRINEDSDGKVFVTSEAMFCSLAELVHHHSVA
GDGLVTQLLYPAPKRDKPSVFPLAPPDHWEIDRTDIVMKHRLGGGQYGDVYEAAWKRGNL
TVAVKTLKDDTMALKDFLEEAGIMKEMRHPNLVQLLGVCTREPPFYIITEFMSRGNLLEY
LRAAHRDKVDAVVLMYMATQIASGMSYLESRSFIHRDLAARNCLVGENHLVKVADFGLAR
LMRDDTYTAHAGAKFPIKWTAPEGLAYNTFSTKSDVWAFGVLLWEIATYGLSPYPGVDLA
DVYHMLEKGYRMECPPGCPPAVYELMRGCWQWHAHDRPTFRDIHHALEHMFPDHSITEEV
EKQLLETGSTGTPQLSARKADAGKGVQMRRPTNRRGKQAPTPPKRTSLLSSCSSFRESQY
AEDCPAPPPGVCDDNGVHNGVGARGRESSEGSLAEPDTDSSGARASARQRAARRRHTPPA
THPPTPNTAKVNI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcagcaagcaaaggaacgcggggcggctggcggcgcgtcgatgcggtcggct
cggagcaagccgcgcgtgccaaaggacccccggcttcttggctccaacatcttcactgaa
cacagcgaagcactgctacagagtcgtccgttgccacacatccccgacctgcccgcggag
agcgcggtgggggacgcggccgccgtcgtgtccacacccctcaccctggacactgccaac
aggtggacctcgaaagagaaccttctggcgcatgttgaagatgaagaccctcagttgttc
gtagccctgtacgacttccaagccgcaggggacaaccagctaacgctgaagaaaggcgag
caagtgcgcatagtgtcgtacaacaagtcgggcgagtggtgcgaagcgcaccggctggca
ggcggcgtgggctgggtgccgtccaactacgtcacgccggtcaactcgctcgagaagcac
tcttggtaccacggccccatcgcgaggaacgccgccgagtatctgctgtcttcggggatt
aacggatcgttccttgtgcgagaatcagagtccagtccgggacagcgcagcatctctctc
cgctacgagggccgagtgtaccactaccgcatcaacgaagacagcgacggcaaggtgttc
gtgacgtcagaagcgatgttctgctctctggccgagctggtccaccaccactctgtggcc
ggcgacgggctggtcacgcagcttctgtaccccgcgccgaagcgagacaaaccatcggtc
ttcccgctcgcacccccggatcattgggagatagaccgcacggatatagtgatgaaacac
aggcttggcggcggccagtatggcgacgtgtatgaggccgcttggaagaggggaaatctc
actgttgctgtcaagactttgaaggacgacacaatggcgctaaaagacttcctggaagag
gccggcatcatgaaggagatgcgccacccgaacctggtgcagttgctgggcgtttgcacg
cgcgagccgcccttctacatcatcaccgagttcatgtcgcgcggcaacctgctcgagtac
ctccgagccgcccacagggacaaggtggacgcagtggtgctcatgtacatggcgacgcag
atcgcgtccggcatgagctacctcgagagccgcagcttcattcaccgcgacctcgcggcg
cgcaactgtctggtcggcgaaaaccacctggtaaaagtggctgacttcggtttggcgcgt
cttatgcgagacgacacatacacagcgcacgccggcgcaaagttcccaataaaatggacg
gcgccggagggactggcgtacaatactttcagcactaagtccgacgtttgggcgtttgga
gtgctcttgtgggagattgccacgtatgggttgtcgccgtacccgggcgttgacttggct
gatgtctatcacatgcttgagaagggctaccgcatggagtgtccgcccggctgcccgccc
gcggtctacgagctgatgcgcggctgctggcagtggcacgcacacgaccggcccaccttc
agggacatccaccacgcactggaacacatgttcccggaccactccatcactgaagaggtg
gagaagcagctgctggagacgggctccacgggcacgccgcagctgtcggctcgcaaggcg
gacgccggcaagggcgtgcagatgcgacgccccaccaaccgccgcggcaagcaggcgccc
acgccgcccaaacggaccagcctgctgtcttcatgcagttcgttccgggagtctcagtac
gcggaggattgcccggcgccgccgcccggggtctgcgacgacaacggcgtacataacggt
gtgggggcgcggggtcgcgagtcgtccgagggttccctcgcggagccggacacggactcg
tcgggcgctcgagcgtcggcccgccagcgcgccgcccgccgccgccacacgccgcccgcc
acgcacccgcccacgcctaacactgctaaggtaaacatttag

DBGET integrated database retrieval system