KEGG   Plutella xylostella (diamondback moth): 105396331
Entry
105396331         CDS       T03915                                 

Definition
(RefSeq) ferulic acid decarboxylase 1-like
Organism
pxy  Plutella xylostella (diamondback moth)
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-GeneID: 105396331
NCBI-ProteinID: XP_011566630
LinkDB
Position
Un
AA seq 366 aa
MFNSVKGYPHSRILVGMHASRERAALLLGCEPSELAKHVGQAVKKPVAPVVVPASQAPCQ
EQVFYADDPDFDLRKLLPAPTNTPIDAEPFFCLGLVLASDPEDSSLTDVTIHRLCVQERD
ELSMFLAAGRHIEVFRKKAEEAGKPLPVTINMGLDPAIYIGACFEAPTTPFGYNELGVAG
ALRQQPVELVQGVAVKEKAIARAEIIIEGELLPGVRVREDQHTSTGHAMPEFPGYCGEAN
PSLPVIKVKAVTMRNHAILQTLVGPGEEHTTLAGLPTEASIRNAVEEAIPGFLQNVYAHT
AGGGKFLGILQVKKRQPSDEGRQGQAALIALATYSELKNIILVDEDVDIFDSDDILWAMT
TRMQGD
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgttcaacagcgtgaagggctatccgcactcccgcatcctggtgggcatgcacgccagc
cgcgagcgcgcggcgctgctgttgggctgtgagccttcggaactggcaaagcacgtcggc
caggcggtgaaaaagccggttgcgccggttgtcgttccggcctcgcaggccccctgccag
gagcaggtcttttacgctgacgatcctgacttcgacctgcgcaagctgcttccggcccca
accaacacgccgattgatgcggagccgttcttctgtctggggctggtgctggcaagcgat
ccggaagacagctcgctgacggatgtcaccatccaccgcctctgcgttcaggagcgcgac
gagctttccatgttccttgccgccgggcgccatatcgaagtcttccgcaaaaaagcggag
gaggcaggaaaaccgctgccggtgacgatcaacatgggtctcgaccccgccatctacatc
ggcgcgtgctttgaggcccctaccacgccgtttggctacaacgagctgggcgtcgccggg
gcgctgcgccagcagccggtcgagctggtgcagggcgtagcggtcaaagagaaagccatc
gcgcgggcggaaatcatcatcgaaggtgaactgctgccgggcgtgcgcgtgagagaggat
cagcacaccagcaccggccacgcgatgccggagttcccgggctactgcggcgaggcgaac
ccctccctgccggtgatcaaagtgaaagccgtgaccatgcgcaaccacgcgatcctgcag
acgctggtgggaccgggggaagaacataccacgctggccggactgccgaccgaggccagc
atccgcaatgccgttgaggaggctattccgggcttcctgcaaaacgtctatgcccatacc
gcgggcggcggcaagttcctcgggatattgcaggtgaaaaaacgccagccgtcagacgaa
ggacgtcagggccaggcggcactcatcgccttagccacctattcggagctgaagaacatt
attctggtcgacgaggacgtggatattttcgacagcgacgacatcctgtgggcgatgacc
acccgcatgcagggcgat

DBGET integrated database retrieval system