KEGG   Plutella xylostella (diamondback moth): 105396414
Entry
105396414         CDS       T03915                                 

Definition
(RefSeq) ferulic acid decarboxylase 1-like
Organism
pxy  Plutella xylostella (diamondback moth)
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-GeneID: 105396414
NCBI-ProteinID: XP_011566713
LinkDB
Position
Un
AA seq 412 aa
MNTIGSWQNHAISMGLPANTPVKKQIDEFIRRWDKFPIAPERRANPAWAENTVDGEDINL
FDILPLFRLNDGDGGFYLDKAGVVSRDPPDPDNFGKQNVAIYRMEVKGKRKLGLQPVPMH
DIALHLHKAEEGGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIATAP
LTGFDVPWGSEVILEGVIEGRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRTKPIFES
LYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGFARA
VGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLELDP
GSSPAGITDKLIIDATTPVAPDTRGHYSQPVQDLPETKAWAEKLTAMLAARQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaacaccatcggctcctggcagaaccacgccatttcgatggggctgcctgcgaatacc
ccggtaaaaaaacagatcgacgagtttatccgccgctgggataaattccccatcgcaccg
gagcgccgcgccaacccggcctgggctgagaatacggtggatggtgaagacatcaacctg
ttcgacatcctgccgctgtttcgcctgaatgacggagacggtggtttttatctcgacaaa
gcgggcgttgtttcgcgcgatccgcctgacccggataacttcggcaagcagaacgtcgcc
atttatcgcatggaggtgaaagggaagcgcaagctcggcctgcagccggtgccgatgcac
gatatcgccctgcatctgcataaagcggaagaggggggggaagatctgccgattgcaatt
actctcggcaacgatccgatcatcaccctgatgggcgcgacgccgctgaaatacgatcag
tcagaatatgagatggcgggtgccctgcgcgaaagcccatacccgattgccaccgcaccg
ttgaccggtttcgatgtaccgtggggctctgaagtgatcctggaaggggtgattgaaggt
cgtaaacgtgaaatcgaagggccgtttggagagtttaccgggcattattccggtggccgt
aatatgacggtggtacgtattgataaagtttcttatcgcacgaaaccgattttcgaatcc
ctgtacctcggtatgccgtggaccgaaattgactatctgatgggcccagccacctgcgtg
ccgttataccagcagctgaaagccgaattcccggaagtgcaggcggtgaacgcgatgtac
acccacggtttgctggcgattatctccaccaaaaagcgttacggcggttttgcccgcgcg
gtcggtttgcgtgccatgactacgccgcatggcctgggctacgtgaagatggtgattatg
gtggatgaagatgttgacccgttcaacctcccgcaggtgatgtgggcgctgtcatcgaag
gtcaacccggcaggcgatctggttcaactgccgaacatgtcggtgcttgaactcgaccct
ggctccagcccggcgggcattaccgacaaactgattattgatgcgacgacgcctgtcgcc
ccggacacccgaggccactatagccagccggtacaggatctgcctgagaccaaagcctgg
gctgaaaaactgaccgcgatgctggcagcacgtcaataa

DBGET integrated database retrieval system