KEGG   Plutella xylostella (diamondback moth): 105396714
Entry
105396714         CDS       T03915                                 

Definition
(RefSeq) ferulic acid decarboxylase 1-like
  KO
K20039  phenacrylate decarboxylase [EC:4.1.1.102]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
Enzymes [BR:pxy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.102  phenacrylate decarboxylase
     105396714
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-GeneID: 105396714
NCBI-ProteinID: XP_011567022
LinkDB
Position
Un
AA seq 575 aa
MDVVDMVCKRADIGDGIVCLIFDGCLSPFADDEVCLHVELTESNQSLDSQDRSCCTTWGT
KYVKESARDAENCRNIGYEAGFCISNLGNPIFEPYHELYKEWQAMIPQARNPLINTEITA
STHRIIMASSQNYSEAAGDLRQFLKELDDENDLLVIKSEVDPEMELAAITRRVYETEDKA
PLFENITGRVGNGLFRVLGAPVGLSRVPGQRLGRIAKSLGLPSTATGKEIIAKINDAKHL
KPLPPNEVASGPVKEHKIFGDEIDLTTLPTPRLHQHDGGKFIQTFGMYIVQRPNGTWTNW
SITRAMVHGKQTLVGPIIPKQDIGVIYQEWKDLGKDMPFALCFGVPPAAIMVGGMPIPKG
EDEAGYIGALVGKPLDAVKCETSDLLVPANAEIVMEGFASISETAPEGPMMEYHGLVYPG
RSKECPLFKVNAITYREDPILPICITGRATEESHTVWAVMIAAEVLNICQNAGLPIQMVW
CPFESHAHWLAIQVNRQELLKLKTNMQDFCVKLGHIVLGSKPGWYIPKVFLVGEDIDPTD
LRDLLWAEATRCEPGTSEFLFDEYGNIPLIPYVAH
NT seq 1726 nt   +upstreamnt  +downstreamnt
atggatgttgtagacatggtctgcaagcgcgcggatattggggatggtatagtctgtctc
atatttgatggttgcctcagcccatttgctgatgacgaggtgtgtctccacgttgagttg
acggagagcaatcagagtcttgactcccaagatcgatcctgttgcaccacatggggcacc
aagtacgtaaaagagtcggctagagatgccgagaattgcagaaacatcgggtacgaagcc
gggttctgtatctccaatttggggaaccccatcttcgaaccatatcacgaactatataaa
gagtggcaggcgatgataccacaagctagaaatccgttgattaatacagagataactgct
tcaactcatcgcatcatcatggcatccagccagaactattccgaagcggccggggacctt
cgccaattcttgaaggaactcgatgatgagaatgaccttcttgtcatcaaatcagaggtc
gaccccgaaatggagttagctgcgatcactcgcagagtctatgagactgaagataaagca
cctttgttcgagaatatcaccggccgagtaggaaacggtctcttccgcgtcctaggagca
cccgtggggctcagccgtgtacctggtcaaagattgggccgcatcgccaaaagtctagga
ttgccttccaccgcaacaggcaaagagatcattgcaaagatcaatgatgccaagcatctc
aagccgttgccccccaatgaagtcgcatctggaccggtgaaggaacacaagatcttcggt
gatgaaatcgacctgaccactcttccaacgcctcgcctccaccagcatgacggtgggaag
ttcatccagaccttcggtatgtacatcgtacagagaccaaacggaacttggaccaattgg
tcaatcactcgagcgatggttcacggcaagcaaacgctcgttggtcctatcatcccaaag
caagacattggtgtgatataccaagagtggaaagacctcgggaaagatatgcccttcgca
ctgtgcttcggcgtcccacccgcagcaatcatggtgggcggcatgccgatccccaaaggc
gaggacgaggccggctacatcggcgctctcgttggcaagccacttgacgcagtcaagtgt
gagacaagcgatcttcttgtccctgccaatgcggagattgtgatggaaggctttgcttca
atttccgagacagcacctgaaggcccgatgatggaataccatggcttggtgtatccgggc
cgaagcaaggaatgccctttattcaaagtcaacgcaatcacctatcgggaggacccaatc
ctgccaatttgcattaccggaagagctaccgaggagagccataccgtgtgggcggtcatg
atcgccgcagaagtgctgaatatctgtcaaaacgctgggctaccgatccagatggtctgg
tgtccgttcgagtcacatgctcactggcttgctattcaagtcaaccgccaagaattgttg
aaactcaagacgaatatgcaagacttctgcgtcaagctaggccatatcgtgctgggctcg
aagcctggatggtacatacccaaggtcttcttggttggagaggacattgatcccacagac
ctccgagacctcctttgggccgaagccacccgctgtgagcccggaaccagcgagttcctg
tttgatgaatatgggaatattcccttgatcccatacgttgcccacg

DBGET integrated database retrieval system