KEGG   Pyrococcus yayanosii: PYCH_00090Help
Entry
PYCH_00090        CDS       T01543                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00630  Glyoxylate and dicarboxylate metabolism
pya01100  Metabolic pathways
pya01120  Microbial metabolism in diverse environments
pya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PYCH_00090
Enzymes [BR:pya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PYCH_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEH23722
UniProt: F8AF48
LinkDB All DBs
Position
6235..7500
Genome map
AA seq 421 aa AA seqDB search
MSKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKLPDM
AKRSMAKVFSLEKSGEGYIAKIAYPLTLFEEGNLVQLFSAIAGNIFGMKALKNLRLLDFH
PPYEYLRHFKGPQYGVKGIREFMGIEDRPLTATVPKPKMGWSVDEYAEIAYELWSGGIDL
LKDDENFTSFPFNRFEERVRKLYAVRDRVEAETGETKEYLINITGPAHVMEKRAQLVAAE
GGQYIMIDIVVVGWSALQYMREVAEDLGLAIHAHRAMHAAFTRNPRHGISMFVLAKAARM
VGVDQIHTGTAVGKMAGDYEEVKRINGFLLSEWEHIKPIFPVASGGLHPGLMPELIRLFG
RDLVIQVGGGVMGHPDGPRAGAKALRDAIEAAIEGVSLEEKAKESPELKKALEKWGYLKP
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggttgagtggtatcttgacttcgttgacctcgactatactcccggaagggac
gagcttatagtggagtactactttgagccgaacggcgtttctccggaggaagccgccggg
agaattgccagcgagagttctatagggacgtggacgactctctggaagctccccgatatg
gcaaagaggagcatggcgaaggtcttcagccttgagaagagtggagaaggctatatagcc
aagatagcatatccgctgacccttttcgaggaggggaacctcgttcagcttttcagcgcc
atagcgggaaacatattcggaatgaaagccctcaagaaccttaggctcctcgacttccac
ccgccctatgaatatcttagacacttcaaggggccgcagtacggggtgaaggggattaga
gagttcatggggatagaagacaggcctttgacggctactgttcctaagcccaagatgggc
tggagcgttgatgaatatgcagagattgcctacgagctttggagcgggggcatcgacctc
ctgaaggacgacgagaacttcacgagcttccccttcaaccgcttcgaggagagggttagg
aagctctacgccgtgagagatagggttgaggccgagactggagagacaaaggagtacctg
ataaacataacgggtccagcccacgtgatggagaagagagcccagctcgtcgcggctgag
ggcggccagtacataatgatagacatcgtcgtcgttggatggagcgccctgcagtacatg
agagaagttgctgaagacctcggtctggcaatccacgcccatagggctatgcatgcagcg
ttcacgaggaacccgaggcacgggataagcatgttcgtcctcgccaaggcggcgaggatg
gtgggcgttgaccagatacacacgggaaccgccgtcggaaagatggccggggactacgag
gaggtcaagagaataaacggcttcctcctcagcgaatgggagcatataaagccaatcttc
cctgttgccagcggcggtctgcatcctggattgatgcccgagcttataaggttatttgga
agggacctcgtcattcaggtgggtggcggcgtgatgggacatccagacggacctagagcc
ggtgccaaggccctcagagatgctatagaggctgccatcgaaggggtcagcctggaggag
aaagccaaggagagccccgagctgaaaaaggccttggagaagtggggctacctgaagccc
aagtga

DBGET integrated database retrieval system