KEGG   Pyrococcus yayanosii: PYCH_06190Help
Entry
PYCH_06190        CDS       T01543                                 

Definition
(GenBank) chromosome segregation protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
pya  Pyrococcus yayanosii
Brite
KEGG Orthology (KO) [BR:pya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pya03400]
    PYCH_06190
DNA repair and recombination proteins [BR:pya03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PYCH_06190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_13 NPV_P10 Rad50_zn_hook AAA_15 AAA_23 DUF1664 AAA_21 Spc7 BLOC1_2 ABC_tran AAA_29 SbcCD_C T3SSipB GAS CREPT Fib_alpha DUF5082 FlaC_arch FtsK_SpoIIIE HMMR_N DNA_ligase_ZBD Atg14 DUF3584 Phage_GP20 DUF4407 AAA_16 Dynamin_N APG6_N
Motif
Other DBs
NCBI-ProteinID: AEH24307
UniProt: F8AI78
LinkDB All DBs
Position
518229..520883
Genome map
AA seq 884 aa AA seqDB search
MRLEKVIIKDFRSHQLTAVDFTPGINLIIGQNGSGKSSILEAILVGLYWPSRPSELKKED
ILRVGGRGTEITVFFEVGGVKYQVHRKIHGSYAHVKYLDNGTWRTIEASGHNAVREWMNR
LISYDVFVNAVYIRQGEIEAILRDDVEREKVVRQVLGIEKLENAYSNLRAVLREIRRRIT
EAEDFLKKTEKVEETIVESERRLIEILSRINELSSKLPELRQELAVVERELKELDEKEKR
INGLKIELERKRGEMRELRAMEGELRKAIEEGKRKIEELKKRLKGLEELEERAKEFKELS
AFLENYRKRKAEIEREISAFEERLRAVEDRIMELEGKIERIAELENKLRELRERLKELEP
FKGKLDEREAIRRELENKRRKLRLSRKEIEKLREEIMRAKSERETLQKRLQELSKLRGEL
ESRMLDREKAIEELKRARGKCPVCGTELTEEHRQELIEKYTLEVSGMEERLREIEEEVGK
IRKKLREVERTLAREVELIKQEELLRQVEELEAKLKSFSPEIEEKAREFERVRDEIGRIE
GEVKGLREEASRLTALKKKRELLKEKLDGRKAWLNELEAELRKKGFGSEDELEKRLRELE
PMYKEYLELRALKGQLEREIKDVAEKEVKLRKVREDVERLRGEIDSIEEELRGLEKTYDP
VRHEEVRKRKERLAVELGKLENELKILEEERERVEKTLEALREQREERKKKMEELKRLKK
AELNAEELRKKIKMYKAAIRERALESVAEIASEIFEELTEGKYSGVVLKADENKLRLFVV
YEGKERPLSFLSGGERIALALAFRLALSMFLAGEMSLLILDEPTPFLDEERRRRLISIME
GYLRKIPQVIVVSHDEELKDAADRVIRVRLEDGVSRVSVEGVVS
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgagaaggtaataatcaaggacttccgctctcaccagctgacagcggtagac
ttcactcccggaataaacctcataattggccagaacggcagcgggaagagctccatcctc
gaggcgattttggtaggcctttactggccatcgcgcccgagcgagctgaaaaaggaagac
atcctgagagtagggggcagaggaaccgagataacggtgttcttcgaggtcgggggtgtg
aaataccaggttcacaggaaaatacacggtagctacgcccacgtcaaatatctcgacaac
ggcacctggaggacgattgaggccagcggacacaatgccgtgagggagtggatgaaccgg
ctcatatcctacgacgtcttcgtgaacgccgtctacataaggcagggggagatagaggca
atactaagggacgacgtggagagggaaaaagttgtcaggcaggtgcttggaatagagaag
ctggagaacgcctacagcaacctgagggctgttctgagagagataaggcgtagaattacg
gaagctgaagacttcctcaaaaaaacggaaaaagtcgaggagactatcgtggagagcgag
aggaggctcattgaaatcctcagcaggattaacgagctctcctccaaactcccagagctc
aggcaggagctcgcggtggttgagagggagcttaaggagctcgacgagaaagaaaagaga
atcaacggtctgaagattgaactcgagaggaagaggggcgagatgagggagctcagggca
atggagggggagctcaggaaggccattgaagaaggaaaaaggaagatagaggagctcaaa
aaaaggctcaaaggtctcgaagaactcgaagagagggcaaaggaatttaaagagctttct
gcattcctcgagaattacaggaagaggaaggccgagatcgagagggaaataagtgcattt
gaggagaggctcagggcagttgaggacaggattatggagctcgaggggaagattgaaagg
attgcagagcttgagaataagttgagagagctcagggagaggctcaaggagcttgagccc
tttaaggggaagcttgatgagagagaagccatcagaagggagctcgaaaataaaagaaga
aagttgaggttgagcagaaaggagattgagaagctcagggaagaaattatgagggcaaaa
agtgagagagagacgcttcagaaaaggttgcaagagctgagcaagctgaggggcgagctc
gaaagcaggatgctcgatagggagaaggcaatcgaggagctcaagagggcgaggggtaag
tgccccgtctgcggtaccgagctgacggaggaacacaggcaggagctcatagagaagtac
actctggaagtctcggggatggaggagaggcttagggagattgaagaagaggttgggaag
ataaggaagaagctcagggaagtcgagaggacgctcgcgagggaggttgagctcataaag
caggaggagcttctgaggcaggtcgaggagctcgaggctaagctgaagtccttcagccct
gagatcgaggagaaggcaagggagttcgagagggttagggatgaaatcggcaggattgaa
ggtgaggttaagggcctgagggaagaagcgagcaggctcactgccctgaagaagaagcga
gagttattgaaggagaagctcgatggcagaaaagcctggcttaacgagcttgaagcagaa
ctcaggaagaagggatttgggagcgaggacgagcttgagaagaggttgagggagctcgag
ccgatgtacaaggaataccttgagttgagggccctgaagggacagctcgagagggagatt
aaggacgttgctgagaaggaagtcaagctaagaaaagtccgggaagatgtcgagagactg
aggggtgagatagacagtattgaggaggagcttaggggtcttgaaaaaacctatgatcca
gtgaggcatgaagaggtgagaaagaggaaggagaggctcgctgtggagctcggaaagctc
gagaacgagctgaagatactggaggaggagagggaaagagtcgagaagacccttgaagct
ctaagagagcagagggaggagagaaaaaagaagatggaggagctcaagaggctcaagaag
gccgagcttaacgccgaagagctgagaaagaagataaagatgtacaaggcagcgataagg
gagcgggccctggagagcgttgctgagatagcgagcgagatatttgaagagctgacggag
ggaaaatactccggagtagtcctgaaggcagatgaaaacaagctcaggctcttcgtggtt
tatgaggggaaagaaaggcccctgagcttcctcagcggcggtgaaaggatagccctcgcc
ttagccttccgcctcgccctctccatgttcctggctggcgagatgagccttctcatcctt
gacgagccaacgcccttcctagatgaggagaggcgcaggaggcttataagcataatggag
ggctacctcagaaagataccccaggtcatagtggtgtcccacgacgaggaactgaaagat
gcggcggatagggtcataagggttcggctcgaggacggtgtttccagggtgagcgtcgag
ggggtggtctcttga

DBGET integrated database retrieval system