KEGG   Pyrococcus yayanosii: PYCH_06610Help
Entry
PYCH_06610        CDS       T01543                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00010  Glycolysis / Gluconeogenesis
pya00020  Citrate cycle (TCA cycle)
pya00620  Pyruvate metabolism
pya00640  Propanoate metabolism
pya00650  Butanoate metabolism
pya00680  Methane metabolism
pya00720  Carbon fixation pathways in prokaryotes
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01120  Microbial metabolism in diverse environments
pya01130  Biosynthesis of antibiotics
pya01200  Carbon metabolism
Module
pya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_06610
   00020 Citrate cycle (TCA cycle)
    PYCH_06610
   00620 Pyruvate metabolism
    PYCH_06610
   00640 Propanoate metabolism
    PYCH_06610
   00650 Butanoate metabolism
    PYCH_06610
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PYCH_06610
   00680 Methane metabolism
    PYCH_06610
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PYCH_06610
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PYCH_06610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF4290 DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AEH24349
UniProt: F8AII3
LinkDB All DBs
Position
complement(559374..560561)
Genome map
AA seq 395 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISACVGAAAAGVRTFTATASQGLALMHEILFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWIQFYAENNQEALDLILIAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPARPITQGTLAFPAHYMEARYKVWEAMERAKEVIDEAF
AEFEKRFGRKYQKIEEYRTDDAEMIFVTMGSLAGTLKEWVDKKREEGYKVGAAKITVYRP
FPVEEIKALAKKTKVLAFIEKNITIGLYGAVFTDASATLINEKEKPLMLDFIAGLGGRDV
TFEQLDEAFSITRRALEEGKVEKPINWIGLRKEIL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggaaggttatgaaggccaacgaggcggccgcttgggcggccaagcttgcc
aagccaaaggtcatagccgcgttccccatcacaccctcgaccctcgtgcccgagaagata
agcgagttcgtggccaacggagagctcgatgctgagttcataaaggtcgagagcgagcac
tccgccatctcggcctgtgttggcgccgctgccgctggcgttaggacgttcaccgccaca
gcttctcagggtcttgctttgatgcatgagatactcttcattgccgcaggcatgaggctt
ccaatagtcatggccataggcaacagagctctatcggctccaataaacatctggaacgac
tggcaggacacgataagccagagagacacgggctggattcagttctatgccgagaataat
caagaagctctcgacctcatcctgatagcctacaaggtggctgaagacgagcgcgttctt
ctcccggctatggttggtttcgacgcgttcatcctaacgcacaccgtcgaaccagttgag
atacctgaccaggaagtcgtggacgaattcctaggcgagtacgagccaaagcacgcttat
ctcgaccccgccaggcccataacccagggcacacttgccttcccagcccattacatggag
gcgaggtacaaggtttgggaggctatggagagggcaaaggaagtcattgacgaggccttc
gccgagttcgagaagaggtttggcaggaagtaccagaagattgaggagtaccgcacagat
gacgccgagatgatcttcgttaccatgggctctctcgccggaaccctaaaggagtgggtg
gacaagaagagggaggagggctacaaggtaggagcagcaaagataaccgtttacaggccg
ttcccagtcgaggagatcaaggcccttgcgaagaagaccaaggtgcttgcgttcatcgag
aagaacatcacaatcgggctctatggagcggtcttcacggatgcctctgccactctcata
aacgagaaggagaagcctctgatgctggacttcatagcgggacttggtggaagggatgtt
accttcgagcaacttgacgaggccttctccataaccaggagggctcttgaggagggtaag
gttgagaagcctattaactggataggacttaggaaggagatactgtga

DBGET integrated database retrieval system