KEGG   Pyrococcus yayanosii: PYCH_07550Help
Entry
PYCH_07550        CDS       T01543                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00500  Starch and sucrose metabolism
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PYCH_07550
Enzymes [BR:pya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     PYCH_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AEH24442
UniProt: F8AIW7
LinkDB All DBs
Position
complement(650241..652751)
Genome map
AA seq 836 aa AA seqDB search
MVTVDNSIKKLIEEKLPENLRSLAELAYNYWWSWDHKAMKLWQKMDEEHWREYKNPVKLL
LEIPESKLKELSRDDSFLDLYELVMERFQGYIKEKTTWFSTNYPKWDKPIVYLCMEYGIS
KSLPIYSGGLGILAGDHLKTASDLGLPFTAIGLLYKHGYFRQEIDKDGRQIEVFPEYNLS
ELPLRQVLTENGRPLLIEVPIENRTVYARVFLVEVGRAKLYLLDTDVPENNEEDRRICDY
LYNAEPDKRIKQEILLGIGGMRLLRALKIEPGVVHLNEGHPAFANFERIRWFMEKGLSFE
EALEVVRGTSIFTTHTPVPAGHDVFPVDFVREKLAKFFEGLPAEKFLDLGSARENDSVFN
MTVLSIKTSNFVNGVSKLHARVSRKMWAELWEGVPVDEIPIEAITNGVHTATWVNENIAR
LYDTYMGKVWREHVNLEGTWYAVERIPDEELWEAHLKAKKELIDLIRRKIMRRNERLGLD
EPLPTIDENALIIGFARRFATYKRAILLFTDLERLKKILNNPERPVYIIFGGKAHPRDEA
GKEFLRRVYEVSRMPEFRGKIILIENYDMGSARIMVAGVDVWLNTPRRPLEASGTSGMKA
GLNGVINLSIFDGWWVEGYNGRNGWVIGDTTTEPETEEDDYRDAMSLYDLLENVIIPLYY
ENREAWIRMMKESIKSIAPRFSTYRMVKEYMTTFYSKAMEMGIYLMRDNFRWAKILAQWR
KKVVETWKDVKIEDVRVEEKKAIEVIVRLGSLTPDDVKVELYYGLTDEEQRITVPNIVEL
RNVEALGDARYKYRYKGRALAKLGEPCWHYAIRVYPHHSMIPQRFILGGFVKWRPL
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggtggacaacagtattaagaagctaattgaggagaagctacccgagaacctg
aggagccttgcggaactagcctacaactactggtggagctgggatcacaaggccatgaag
ctctggcagaagatggatgaggagcactggagggagtataaaaatcccgtcaagctcctc
cttgaaataccggaatccaagctaaaggaactctcccgcgacgactccttcctcgacctc
tacgagctcgttatggagagattccaaggctatattaaggagaagacgacctggttctca
acgaactatcccaagtgggataagccgatagtatacctctgtatggagtatggcataagc
aagagcctgcccatttattcgggtggcctgggaatactggcgggggaccaccttaagacc
gcgagcgaccttggccttcccttcactgccatagggctcctctacaagcacggctacttc
cgccaggagatagataaggacggccgacagatagaggtcttcccggagtacaatctaagt
gagttacccctcaggcaggttctcaccgagaatggcaggccacttctcatcgaagttccc
atagagaacagaaccgtctatgcaagggtcttcctcgtcgaggttggcagggcgaagctc
tatcttctcgacaccgacgtgccggagaacaacgaggaggacaggaggatatgcgactac
ctctacaacgctgaacccgacaagaggataaagcaggagatactccttggaatcggcggc
atgcgcctcctaagggcccttaagatagagccgggcgtcgtgcacctgaacgagggtcat
ccggccttcgcaaacttcgagaggataaggtggttcatggagaagggcctgagcttcgag
gaggcccttgaagttgtcagggggacaagcatattcacaacccacacgcccgtccctgct
ggtcacgacgtctttcccgtggacttcgtcagggagaagctcgccaagttctttgagggc
ctgcctgctgagaagttcctcgacctcgggagtgcccgggagaatgattcggtattcaac
atgaccgttctgtcaataaaaacctctaacttcgtcaatggagtaagcaagctccacgct
cgcgtgtcgaggaagatgtgggcggagctctgggagggcgttccggtagatgagatccca
atagaggccataaccaacggtgtccacacggctacctgggttaatgagaacatcgccagg
ctttatgacacctacatgggcaaagtgtggagggagcacgtaaacctcgaaggaacatgg
tacgcggtggagagaataccagatgaagagctctgggaggcacaccttaaggccaagaag
gaactcatcgaccttataagaaggaagatcatgaggagaaacgagcgccttgggcttgat
gaacccctgcccaccatagatgagaatgccctaattatcgggtttgctaggcgcttcgcg
acctacaagagggccatcctcctattcaccgatcttgagaggcttaagaagatcctgaac
aacccggagaggcctgtttacataatcttcggcggtaaggcccacccaagagacgaagcc
ggaaaggagttcctccgtagagtctacgaggtctcgaggatgcccgagttcaggggcaag
ataatccttattgagaactacgacatgggaagcgcccgtattatggttgcaggcgttgac
gtgtggctcaacacccctcgcaggccccttgaagccagcggaacgagcgggatgaaggcg
ggccttaatggcgtgataaacctcagcatcttcgacggttggtgggtggaagggtataat
ggaaggaacggatgggtaatcggagacactacgacggagccagagaccgaggaggacgat
tatcgggacgcgatgagcctctacgacctcctcgaaaacgtcataatccccctctactac
gagaacagagaggcctggataaggatgatgaaggagagcatcaaaagcatagcgccgagg
ttcagcacatataggatggtgaaggagtatatgacgacgttctactcaaaggctatggaa
atgggcatatacctcatgagagacaacttcaggtgggcaaagatactcgcccagtggaga
aagaaggttgtggaaacctggaaggacgtgaagatagaggacgtcagggtggaagaaaag
aaggccatcgaggtcattgttaggctgggtagtctaaccccagacgacgttaaggtcgag
ctctactacggactaaccgacgaggaacagaggataaccgttcctaacatcgtggaactc
agaaacgtcgaggctctgggagacgcccgctataaatacaggtataagggcagggcgctg
gcgaagctcggtgagccctgctggcactacgccattagagtttacccacaccattccatg
ataccccagcgctttattctcggtggcttcgtgaagtggaggcctctatag

DBGET integrated database retrieval system