KEGG   Pyrococcus yayanosii: PYCH_09430Help
Entry
PYCH_09430        CDS       T01543                                 

Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00030  Pentose phosphate pathway
pya01100  Metabolic pathways
pya01120  Microbial metabolism in diverse environments
pya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PYCH_09430
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PYCH_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEH24628
UniProt: F8AEB6
LinkDB All DBs
Position
831383..833203
Genome map
AA seq 606 aa AA seqDB search
MFGYNGKILRVNLSDETIKEETFNEAFAKRWLGTRGFGIYYLLKEIDPTIDPFSPENKLI
FATGPLTGTSAPTGGRYMVITKSPLTEYVAMANSGGFFGPELKFAGWDALIIEGKANHPV
YIYINDESVEIKDASHLWGKVVSETEERLKEEVGDKNVQIASIGPAGENKVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAIVVRGHKKVEVADKGKFMEVVREKIEKLKKDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQKGVFEYAYEQSGEAMAAKYLTKNKPCFACPIGCGRVNR
LPTLGITEGPEYESVWALGANLGINDLASIIEANHLADEFGMDTISLGGTLATAMELYEK
GLLKQEDIGEDAPPFRWGNTEVLHYYVEKIARREGFGDVLAEGGYRLAEKFNGLEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDISDEKVKMVI
LFQDLTALVDAAGLCVFTTFGLGADDYRDLLNAALGWDFSTEDYLKIGERIWNAERLFNL
KAGLDPVKEDTLPKRLLEEPMPEGPHKGHVVRLKEMLPRYYKFRGWTEDGRIPEEKLKEL
GLEEFI
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctacaatgggaagatacttcgtgtaaatctctccgacgaaacaattaaggag
gagaccttcaacgaggccttcgccaagaggtggcttggaacgaggggcttcggcatctac
taccttctaaaggaaattgaccctaccatcgaccccttcagccctgagaacaagcttata
ttcgccacaggcccgctgactggaacctctgcccccacgggcggcagatacatggtgatt
accaagagccccctgactgaatatgtagccatggcaaattctggcggcttcttcggacct
gagctcaagtttgcaggctgggacgccctgataatcgagggcaaggctaatcatcctgtc
tacatatacataaatgacgagagtgtcgagattaaggacgctagccacctctggggcaag
gttgttagcgagaccgaggagaggcttaaggaggaggtcggcgacaagaacgttcagata
gcatccataggaccagccggtgagaacaaggttcgcttcgcggctgttatgaacaacgga
cacagagcagcgggaaggggcggtgtcggagccgtcatgggaagcaagaacctcaaagcc
atagttgtcaggggtcacaagaaggtcgaggttgcggacaagggcaaattcatggaggtc
gttagggagaagatagagaagctgaagaaggatcctgtggccggcggcggcttgcccaag
tacggaaccgccgttctcgttaacattatcaacgagaacggcttatatccaacgagaaac
ttccagaaaggagtgtttgagtacgcatatgagcaaagcggtgaagcgatggccgccaag
tatctcacaaagaataagccgtgctttgcttgtccaatcggctgtggtcgcgttaacagg
cttccgacccttggaatcacggaggggcctgagtatgaaagcgtctgggctctcggtgct
aacctcggcataaacgacctcgcgagcataatagaggccaaccacctcgccgatgagttt
ggaatggacacaataagtctcggcggaactttggctactgccatggaactctacgagaag
ggccttctcaagcaagaagatattggggaggacgcgccaccctttaggtggggcaacacc
gaggttctccactactacgttgagaagatcgcacgcagagaaggctttggagatgttctc
gccgaaggtggctaccgccttgcggagaagttcaacggcttggaatacttcatgggggtc
aagaagcaggagcttccggcctacgatccaaggggtgctgaagggcatggcctcggctac
gcaaccaacaaccgtggtggctgtcacatcaagcagtacatgataagccccgagatactc
ggctacccgtacaagatggatccacacgacatcagcgacgagaaggtcaagatggtcatc
ctcttccaggacctcacggcactagtagacgccgccggtctctgtgtcttcacaacgttc
ggtctcggcgccgacgactaccgcgacctcttaaacgcggccctcggctgggacttcagc
accgaggactacctcaagataggcgagagaatatggaacgctgagaggctcttcaacctc
aaggccggtctcgatccagtcaaggaggacaccttgccgaagaggcttctcgaggagccc
atgccggaaggaccacacaaaggccatgttgtgcgcctgaaggagatgcttccacgctac
tacaagttccgtggctggaccgaggacgggaggattccagaggagaagctcaaggagctc
ggcctcgaagagtttatttga

DBGET integrated database retrieval system