KEGG   Pyrococcus kukulkanii: TQ32_04740Help
Entry
TQ32_04740        CDS       T04365                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pyc  Pyrococcus kukulkanii
Pathway
pyc00260  Glycine, serine and threonine metabolism
pyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TQ32_04740 (tdh)
Enzymes [BR:pyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TQ32_04740 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AMM53864
UniProt: A0A127B990
LinkDB All DBs
Position
899804..900850
Genome map
AA seq 348 aa AA seqDB search
MSEKMVAIMKTKPEYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEVGPGVEGIEVGDYVSAETHIVCGKCYACRRGQYHVCQNTKIFGVD
TDGVFAEYAIIPVQNVWKNPKSIPPEYATLQEPLGNAVDTVLAGPIAGKSVLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVF
LEFSGAPKALEQGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKALTVYGITGRHLWETW
YTVSRLLQSGKLNIDPIITHKYKGFDKYEEAFELMRAGKTGKVVFMLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaagatggtagctatcatgaagacaaaaccagaatacggtgctgagcttgtg
gaagtcgatgtcccaaagcctggtcctggggaggttctcattaaggttttagcaaccagt
atttgtggcaccgatctgcacatctatgagtggaatgaatgggctcaatcaagaataaaa
cctccccaaataatgggccacgaagttgccggagaggttgttgaggtaggtcccggtgta
gagggtatagaagttggtgactatgtatcagctgaaacccatatcgtttgtggtaagtgt
tacgcttgtagaaggggtcagtaccacgtctgccagaacacgaagatatttggcgttgat
accgatggagtttttgcagagtacgcaataattcctgtccaaaacgtctggaagaatcct
aagagcatacctcctgagtatgcaaccctccaggaacctttagggaatgcagttgatacg
gttttagcaggtccaatagctggaaagagcgtcctcataactggagcaggtccgcttgga
ctattaggaattgccgtagctaaggcctctggagcttatcctgtcatagtttctgaacca
agtgaattcagaagaaatctcgcaaagaaagttggagcggactatgttattaacccattt
gaggaggatgtagtcaaagaggtaatggatataaccgacggaaatggggttgacgtattt
cttgagttcagtggtgctcctaaagctttagaacagggtctccaagcagtaactccggcc
ggtagggtttccctcttaggattattccctgggaaggtcagtatagattttaacaatctg
ataatattcaaagctctgaccgtttatggaattaccggtaggcacctctgggagacttgg
tacacagtttcaagactccttcagagtggaaagcttaacattgacccaattatcacccat
aaatacaagggattcgataagtacgaggaagccttcgagttaatgagagctggcaaaact
ggaaaagttgttttcatgttaaaataa

DBGET integrated database retrieval system