KEGG   Paracoccus yeei: A6J80_06035Help
Entry
A6J80_06035       CDS       T04781                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pye  Paracoccus yeei
Pathway
pye00240  Pyrimidine metabolism
pye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A6J80_06035
Enzymes [BR:pye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A6J80_06035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 TruB_C
Motif
Other DBs
NCBI-ProteinID: ARC38437
UniProt: A0A1V0GX90
LinkDB All DBs
Position
728865..729443
Genome map
AA seq 192 aa AA seqDB search
MARLYFHYSTMNAGKSTMLLQASHNYRERGMRTLLLTAALDDRAGPGLIASRIGIAEPAT
TFAPDTDLFALVRDRGAGCACVLLDEAQFLSQAQVWQLARVVDDLDLPVMCYGLRVDFRG
QLFPGSAALLAWADELREVRTVCHCGRRATMVIRRDDHGRALRDGAQVQVGGNETYVSLC
RRHWREAMGEIR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccaggctttattttcattattccacgatgaacgcgggcaaaagcacgatgcttttg
caggcctcgcacaattatcgcgaacgcggcatgcgcacgctgctgctgacggctgcgctg
gacgaccgcgccggaccgggcctgatcgccagccgcatcggcatcgccgaacccgccacg
acctttgcccccgacaccgatctgttcgccctggtccgcgaccggggcgcgggctgcgcc
tgcgtccttctggacgaggcccagttcctcagccaggcacaggtctggcaactcgcccgc
gtcgtcgacgaccttgacctgccggtgatgtgctatggcctgcgcgtcgatttccggggc
cagctgtttcccggctcggcggcgctgctggcctgggcggacgagctgcgcgaggtgcgc
accgtctgccattgcggtcgccgcgccaccatggtcatccgccgggacgaccacggccgg
gcgctgcgcgacggcgcgcaggtccaggtcggcggcaatgaaacctatgtctcgctctgc
cgccgccattggcgcgaagcgatgggagaaatccgatga

DBGET integrated database retrieval system