KEGG   Paracoccus yeei: A6J80_11690Help
Entry
A6J80_11690       CDS       T04781                                 

Gene name
rbcL
Definition
(GenBank) form I ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pye  Paracoccus yeei
Pathway
pye00630  Glyoxylate and dicarboxylate metabolism
pye00710  Carbon fixation in photosynthetic organisms
pye01100  Metabolic pathways
pye01120  Microbial metabolism in diverse environments
pye01200  Carbon metabolism
Module
pye_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pye_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A6J80_11690 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A6J80_11690 (rbcL)
Enzymes [BR:pye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A6J80_11690 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ARC36944
UniProt: A0A1V0GSV1
LinkDB All DBs
Position
1875866..1877332
Genome map
AA seq 488 aa AA seqDB search
MNEMSKTQITDAKKRYAAGVLKYAQMGYWDGDYQPKDTDVLALFRITPQEGVDPIEAAAA
VAGESSTATWTVVWTDRLTACDQYRAKAYKVEPVPGTPGQYFCYVAYDLILFEEGSIANV
TASIIGNVFSFKPLKAARLEDMRFPVAYMKTFAGPPTGIVVERERLDKFGRPLLGATTKP
KLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYCMEAVNKATAATGEVK
GHYLNITAGTMEEMYRRAEMAKELGSVIVMVDLIVGWTAIQSISNWCRQNDMILHMHRAG
HGTYTRQKNHGISFRVIAKWLRMAGVDHLHCGTAVGKLEGDPMTVQGFYNVCREIHNDVD
LPRGIFFEQDWGNLKKVMPVASGGIHAGQMHQLIDLFGDDVVLQFGGGTIGHPMGIQAGA
TANRVALEAMVLARNEGVDIKTEGPEVLRKAAKWCKPLEAALDTWGNITFNYTSTDTSDF
VPTESVSY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgagcaagacccagatcaccgacgccaagaagcgttacgcggcgggtgtg
ctgaaatacgcgcagatgggctattgggacggcgactaccagcccaaggacaccgatgtg
ctggcgctgtttcgcatcacgccgcaggagggcgtggaccccatcgaggccgctgctgcc
gtcgccggagaaagctcgaccgcgacctggacggtggtctggaccgatcggctgacggcc
tgcgaccagtaccgcgccaaggcctacaaggtcgaacccgttccgggcacaccggggcag
tatttctgctatgtcgcctatgacctgatcctgttcgaggaaggctccatcgccaacgtc
acggcgtcgatcatcggcaacgtcttcagcttcaagccgctgaaggccgcgcggctcgag
gacatgcgctttccggtggcctacatgaagaccttcgccggcccgccgaccggcatcgtc
gtcgaacgcgagcgcctggacaagttcggccgcccgctgctgggcgccaccaccaagccc
aagctggggctttcgggcaagaactatggccgggtggtctatgaggggctgaagggcggg
ctcgacttcatgaaggatgacgagaacatcaactcgcagcccttcatgcactggcgcgac
cggttcctgtactgcatggaggcggtgaacaaggcgaccgctgcgaccggcgaggtcaag
ggccattacctgaacatcaccgccggcacgatggaggagatgtatcgccgcgccgagatg
gccaaggaacttggctcggtcatcgtcatggtggacctgatcgtgggctggaccgcgatc
cagtcgatttccaactggtgccggcagaacgacatgatcctgcacatgcaccgcgccggc
cacggcacctatacccggcagaagaaccacggcatcagtttccgcgtgatcgcgaaatgg
ctgcgcatggcgggggtggaccacctgcattgcggcaccgccgtcggcaagctggagggc
gatccgatgaccgtgcaggggttctacaacgtctgccgcgagattcataacgatgtcgac
ctgccgcgcggcatcttctttgagcaggactggggcaacctgaaaaaggtgatgccggtc
gcctcgggcggcatccatgccgggcagatgcaccagctgatcgacctgttcggcgacgac
gtggtcctgcagttcggcggcggcaccatcggccacccgatgggcatccaggccggcgcg
accgccaaccgcgtggcgctggaagccatggtcctggctcgcaacgagggcgtggacatc
aagaccgaaggccccgaggtgctgcgcaaggctgccaaatggtgcaagccgctggaggcc
gcgctggatacctggggcaacatcaccttcaactacacctcgaccgacacctcggatttc
gttccgaccgagtccgtcagctactaa

DBGET integrated database retrieval system