KEGG   Paracoccus yeei: A6J80_11985Help
Entry
A6J80_11985       CDS       T04781                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pye  Paracoccus yeei
Pathway
pye00250  Alanine, aspartate and glutamate metabolism
pye00410  beta-Alanine metabolism
pye00640  Propanoate metabolism
pye00650  Butanoate metabolism
pye01100  Metabolic pathways
pye01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A6J80_11985 (gabT)
   00650 Butanoate metabolism
    A6J80_11985 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6J80_11985 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A6J80_11985 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pye01007]
    A6J80_11985 (gabT)
Enzymes [BR:pye01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A6J80_11985 (gabT)
Amino acid related enzymes [BR:pye01007]
 Aminotransferase (transaminase)
  Class III
   A6J80_11985 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARC36996
UniProt: A0A1V0GT08
LinkDB All DBs
Position
1933929..1935197
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYAERAENAEIWDAKGNRYIDFAAGIAVVNTGHRHPRVV
QAVRDQLDRFTHTCHQVVPYESYVALAERLNAAVPGDWPKKTAFYTTGADAVENAVKIAR
HYTGRAGVVAFSGGFHGRTYLGMSLTGKVQPYKAGFGPMMNDIWHLPFPVELHGTSQQDA
LAALDRLFKSDIDPARVAAIVVEPVQGEGGFYEVPPGFMQRLREICDQYSMLLIADEVQT
GFARTGRLFAMEHHGVAADLTTMAKGLGGGLPISAVTGRAEVMDSPAPGGLGGTYAGNPL
AVAAAHAVLDVIAEEDLCARATRLGQRLKQRLAGIAHDVPEIVDIRGPGFMNAVEFNIAG
SDKPNPEMTNRVREEALGRNLILLTCGVHGNVIRFLAPLTIPEAVFDEALDILEDSIRAA
RS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaacgccgccatctcgcgcggggtgggcatgacgacg
cagatctatgccgagcgcgccgaaaatgccgagatctgggatgccaagggtaaccgctat
atcgatttcgccgccggcatcgccgtggtcaacaccggccaccgccacccgcgcgtggtg
caggcggtcagggaccaactggaccgctttacccacacctgccaccaggtcgtgccctat
gaaagctatgtcgccctggccgagcggctgaacgcggcggtgccgggcgactggcccaag
aagaccgcgttctacaccaccggggccgatgcggtggaaaacgccgtcaagatcgcgcgg
cattacacgggccgggccggggtggtggccttctcgggcgggtttcacggccgcacctat
ctgggcatgtcgctgaccggcaaggtccagccctacaaggcgggcttcgggccgatgatg
aacgacatctggcacctgccctttccggtcgaactgcacggcaccagccagcaggatgcc
ttggcggcgctggaccggctgttcaagtccgacatcgacccggcccgcgtcgccgccatc
gtcgtcgagccggtgcagggcgagggcggcttctatgaggtcccgcccggcttcatgcag
cgtctgcgcgagatctgcgaccagtattccatgctgctgatcgccgacgaggtgcagacc
ggctttgcccgcaccggccggctgttcgcgatggagcatcacggcgtcgcggccgacctg
accaccatggccaagggcctgggcggcgggctgccgatcagcgccgtgaccggtcgggcc
gaggtgatggacagccccgccccggggggccttggcggcacctatgccggcaatccgctg
gccgtggcggccgcccatgccgtcctcgacgtgatcgccgaggaggacctttgcgcccgc
gcgacccgcctgggccagcggctgaagcagcgcctggccgggatcgcccatgatgtaccg
gaaatcgtggacatccgcggccccggcttcatgaacgcggtcgaattcaacatcgcagga
tccgacaagcccaaccccgaaatgacgaaccgcgtccgcgaggaggcgctcgggcgcaac
ctgatcctgctgacctgcggcgtccacggcaatgtcatccgcttcctcgcgccgctgacc
atccccgaggcggtcttcgacgaggcgctggacattctggaggattcgatccgcgccgcc
cgcagctaa

DBGET integrated database retrieval system