KEGG   Paracoccus yeei: A6J80_14015Help
Entry
A6J80_14015       CDS       T04781                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
pye  Paracoccus yeei
Brite
KEGG Orthology (KO) [BR:pye00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    A6J80_14015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ARC37337
UniProt: A0A1V0GU15
LinkDB All DBs
Position
2341333..2342076
Genome map
AA seq 247 aa AA seqDB search
MWSATDALLIGSAVFAAAVLRGITGFGFALAAVPLISLVLAPVQGAAIAILLQCMIGLGD
LVSVRRMIDIRTLTMMSAGAVIGTPVGLMTLQLLSANAMRVVIAIIVLGALVSLVRKVRL
APGPRQAIGAGVLAGMFSGFAAMPGPPAVAYLLGTATPAAEARATLMIFFFVTSLLALPG
LLVQGVVGWAIVLAAVASLPLLIAGTHLGGWVFRRLDDGGYQKAAIAMLVVTAVLAAIRG
LWGLAGG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcagcaaccgatgccctgctgattggtagtgcggttttcgccgcggccgtcctg
cgcggcatcacgggcttcggctttgccctggccgcggttccgctgatcagcctcgtgctg
gcgccggtgcagggcgcggcgatagccatcttgctgcaatgcatgatcgggttgggcgac
cttgtttcggtccgccgcatgatcgacatcaggacgctgacgatgatgtcggccggggcg
gtgatcggcacaccagtgggcctgatgacgttgcagctgttatccgccaatgcgatgcgc
gtggtaatcgccatcatcgttctgggggcattggttagcctggtccgcaaggtccgcctt
gcgccgggaccacgccaggccataggcgccggcgttctggccgggatgttctcaggcttt
gcggcgatgcccggcccgcctgccgttgcctatctgctgggaacggcgacgcccgccgcc
gaagcccgcgcgacgctgatgatctttttcttcgtcacctcacttctggcgctgcccggc
ctgctggtgcagggcgtcgtgggatgggcgatcgtgttggctgcggtggcctcgctgccg
ctgctgatcgcgggcacgcatttgggcggttgggtgttccgcaggctggacgacggcgga
taccagaaggccgcaatcgcaatgctggtggtgaccgccgtcctagcggcaattcgcggc
ctgtggggcttggccggcggctaa

DBGET integrated database retrieval system