KEGG   Paracoccus yeei: A6J80_21295Help
Entry
A6J80_21295       CDS       T04781                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pye  Paracoccus yeei
Pathway
pye00061  Fatty acid biosynthesis
pye00780  Biotin metabolism
pye01100  Metabolic pathways
pye01130  Biosynthesis of antibiotics
pye01212  Fatty acid metabolism
Module
pye_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A6J80_21295
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A6J80_21295
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A6J80_21295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pye01004]
    A6J80_21295
Enzymes [BR:pye01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A6J80_21295
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A6J80_21295
Lipid biosynthesis proteins [BR:pye01004]
 Fatty acid synthase
  Component type
   A6J80_21295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ARC38840
UniProt: A0A1V0GYH2
LinkDB All DBs
Position
unnamed4:71720..72484
Genome map
AA seq 254 aa AA seqDB search
MIDLKGKRGLVVGVANEASIAAGCARAFRAAGAELALTFLNEKARPWVEPVAQEVGAPLF
LPCDVREPGQLEAVFDRITAEWGRLDFLLHAIAFAPREDLHTSVVNASAEGFATAMDISC
HSFLRMARLARPLMQAGGSLITVSFYGADRVVENYNLMGPVKAALEASVRYAAADLAGEG
IRAFSLSTGPVKTRAASGIDRFDALMDKIRARTPAGKLVSIEEIGTLAAFLATEAASPMS
GSVVYADNGFHTTA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctgaaaggcaaacgcggcctcgtggttggcgtggcgaatgaggccagcatc
gccgccggttgcgccagggcctttcgcgcggcgggggcagagctggcgctgacctttctt
aatgaaaaggcccggccatgggtcgaacccgtggcgcaggaagtgggtgcgccgctgttc
cttccttgcgatgtgcgtgaacccggccagttggaagccgtgtttgaccgcattaccgct
gaatgggggcggcttgattttctgcttcatgccatcgccttcgccccgcgcgaggatctg
cacaccagcgttgtcaacgcttcggccgaaggttttgcgacggcgatggatatctcttgc
cactccttcctgcgcatggcgcggctggcgcggcctttgatgcaggcgggtggttcgctg
atcacggtcagcttttacggcgcggatcgggtggtcgagaattacaacctcatgggtccg
gtaaaggccgcgctggaggcttcggtccgctatgcggcggccgatctggcgggcgaaggg
attcgtgccttttcgctttcaaccggtccggtcaagacccgcgccgcctcggggatcgac
cggttcgatgcgctgatggataagattcgcgcccgtacgcctgcgggaaaactggtaagc
atcgaagagatcggtacgctggcggcctttctggcaaccgaggccgcaagtcccatgagc
ggatcggtggtctatgccgataacggatttcacaccaccgcctga

DBGET integrated database retrieval system