KEGG   Paenibacillus yonginensis: AWM70_02120Help
Entry
AWM70_02120       CDS       T04810                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg00473  D-Alanine metabolism
pyg01100  Metabolic pathways
pyg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pyg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWM70_02120
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AWM70_02120
Enzymes [BR:pyg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AWM70_02120
Peptidoglycan biosynthesis and degradation proteins [BR:pyg01011]
 Precursor biosynthesis
  Racemase
   AWM70_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PAAR_motif
Motif
Other DBs
NCBI-ProteinID: ANS73523
UniProt: A0A1B1MWG6
LinkDB All DBs
Position
484581..485759
Genome map
AA seq 392 aa AA seqDB search
MQVNYRPTVAEIDLDAMESNYLALRQSLPEGMKLLICVKANAYGHGAVHVAEEMQRLKAD
YLSVAFLDEALELRAAGITMPILVLGYTPPEGVRTAWDHGITICIFDEEVLEAARRLGPE
ASKSRLKVHIKVDTGMGRIGLLPDEAPAFVQQAVSVPGIEVEGLFTHFSTADEKDKSYTL
EQYRRFQDVTDALKELQIKVPIIHTGNSATAIDLPELSFDMVRVGIAIYGLYPSDEVRSQ
NVKLIPVLSLKTRLSYVKELPPGWGISYGKRYETQNWEKIGTLPVGYADGYSRMLGGKAH
VLIRGRRVPVVGTICMDQCMVSLQDFKDNGEQIQVGEEAVLIGRQQGGEISADELASWLG
TIHYEVICMIAHRVPRVYKKAGRQDEIVNPLF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgaattatcgaccgactgttgcagaaattgatctggatgctatggaatccaat
tacctggcactcagacagtccctgccggaagggatgaaactgctgatctgcgtgaaagct
aacgcttatgggcatggagcggtgcatgtagccgaagaaatgcagcgtctgaaggcggac
tatttaagcgtggctttcctggatgaggcgctggaactgcgggcggcaggcattaccatg
ccgatcctggttctgggttatacgccgccggaaggagtgcgtacggcttgggatcatggc
atcacgatctgcatctttgacgaggaagtgctggaagccgcccgcaggcttggaccggag
gcttccaaatccaggctgaaggtccacattaaagtggataccggaatgggacgtatcgga
ttgctgccggatgaggcgccggcgtttgtgcagcaggcagtttctgtaccgggcattgag
gtcgaagggctgttcacccatttttccaccgcagatgaaaaagacaaatcttatacactt
gaacaatacagaaggtttcaggacgttacggacgcgctgaaggagcttcagatcaaggtg
cctattatacatacgggcaacagcgccacagcgatcgatctgccggaactttcctttgat
atggtacgggtcgggattgccatttacggactgtacccgtcggatgaggttcgtagccag
aacgtgaagctgataccggtactttcgctcaaaaccagattgtcatatgttaaagaattg
ccgccgggctgggggatcagctacgggaaaagatacgaaacgcagaattgggaaaagatc
ggcactttgcctgtcggttatgccgacggctattcccggatgcttggcggtaaagcgcat
gtcctgatacgcgggcgccgcgttccagtggttggaaccatctgtatggatcagtgtatg
gtatctctgcaagacttcaaggataacggagaacaaattcaagtcggcgaggaagctgtt
ctgatcggccggcagcagggcggagaaatttccgcggatgagctggcttcctggctggga
acgatccactatgaggtgatctgcatgattgcccaccgggtgccccgggtttataagaaa
gccggacgccaagacgaaatcgtgaacccgctgttctaa

DBGET integrated database retrieval system