KEGG   Paenibacillus yonginensis: AWM70_10580Help
Entry
AWM70_10580       CDS       T04810                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pyg  Paenibacillus yonginensis
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pyg01001]
    AWM70_10580
Enzymes [BR:pyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AWM70_10580
Protein kinases [BR:pyg01001]
 Serine/threonine kinases: Other
  Bacterial family
   AWM70_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Haspin_kinase Kdo RIO1 FTA2 YrbL-PhoP_reg KIND
Motif
Other DBs
NCBI-ProteinID: ANS74992
UniProt: A0A1B1N0P2
LinkDB All DBs
Position
complement(2289998..2292169)
Genome map
AA seq 723 aa AA seqDB search
MIGHEIGGRYQILERIGGGGMALVYKAQDLLLNRHVAIKVLRQQFVNDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGEENEIYYIVMEYVEGQNLNEIIKERAPLQVDEAVRIASQICDA
LDHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSATITQTGSVVGSVHYFSPEH
AKGVAAGEKSDLYSLGIVLYQMLTGKLPFHGESPISVALKHLQEDFEEPRLVNPMIPQSV
ENIICKSMRKNPGERYNSAKEMLLDLETCLLPERRTEPKLEFGPEDEDNTLIIPAIKPQP
AGAAKGRRSRDYEDDDVPEKAPKEPERKRKSRKPWIWAGIVLAIIVILGSMALYFKNQLE
VSDVTVPNLIGLTQDEARTKLTEQGLTVGNVKQAYNKDYDPDVVYEQSKPEGTEVKEGAL
IDLTVSTEKPLEKMIDLSGMTLEQAKQQLTNLGVSGDSITSTEEFNDTVEAGKVISQDPA
PNSDFDPEIASVRLTISKGKESVTMPDLTGLDQKAAKSKLDDLGLSMVTKQESSFTVDKG
LVIEQWPYKPGDSAEPGEEVTLTISTGYPEDAVNYSYGIPVAPAQADKNSKIRIVFTDAR
GENQDWGTKTINTVQTLSVDLVLAPNKDATVSVYRDGQLFDTYRVSYIDAKQGTVPTPEL
PVTAPPESNDPGQGESYVPGESDEDGSGNDVTGMNNKGNYAGNSLASVDIKHGHDKSKNK
DGR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcacgaaatcggcggccgctatcagattcttgagcgtataggcggaggtggc
atggccctggtctataaagctcaagatctgctgctgaaccgtcacgtcgcgatcaaggtg
ctgaggcagcagttcgttaacgacgaagaatttatccgccgcttccgccgggaagcgcag
tctgctgcatcgctttcccatccgaatgtagtgagtatttacgatgttggcgaagaaaat
gaaatatactacatcgtgatggaatacgtcgaaggccagaatctgaatgaaattattaag
gagcgcgctccgctgcaggtcgatgaagcggtacggatcgcgtcccaaatttgtgatgcg
ctggatcatgcccatcagaaccaaatcattcaccgggatattaaacctcataatattttg
ataggccgcaacggacgggtgaaagtgaccgatttcgggattgcgcgggcggtcacttca
gcgacgattacccaaaccggttcggttgtgggttctgtgcattatttctcccctgagcat
gctaaaggagttgcggcgggggagaagtcggatttgtattctcttggcatcgtgctctat
caaatgctgacgggcaaacttcctttccatggcgaaagcccgatcagcgttgccctgaag
cacctgcaggaggatttcgaggagccgcgtctggtcaaccctatgattccgcagagcgtc
gagaatattatttgtaagtcgatgcggaaaaatcccggcgaacgttacaactccgccaag
gaaatgctgctggacctggagacttgtctgctgccggagcgcagaacggagcccaagctg
gagtttggtccggaggatgaggacaacacgctgatcatccctgcgatcaaacctcagccg
gctggagcggcgaaaggcagaagaagccgcgattacgaagatgacgatgtgcctgagaag
gcgcctaaggaacccgagagaaagagaaaatccagaaaaccgtggatttgggccggcatt
gttcttgctattatcgttattcttggaagcatggccttgtatttcaagaaccagctggaa
gtgtcggatgtgacggttccgaatctgattggtttgactcaggatgaagccagaacaaaa
ctgaccgagcagggccttacggtcggcaacgtcaagcaggcttataacaaggattatgat
cctgatgtcgtctatgagcaaagcaaaccagagggcaccgaagttaaggagggggctctg
attgacctgacggtcagcaccgagaagccgctggagaaaatgatcgatctgagcggaatg
acgctggagcaagccaaacagcagctcacgaacttgggtgtaagcggagactctattacc
agtaccgaggaattcaacgataccgttgaagctggcaaggtcatcagccaggaccctgcg
cccaacagtgactttgatccggaaatcgcttcggttcgtctgacgatcagcaaaggcaaa
gaatcggtaacgatgccggatttgaccggactggaccagaaagcggctaaaagcaagcta
gacgatctgggcttgtcgatggttacgaaacaagagtcaagctttacggttgacaaaggt
ttggtcatcgagcagtggccttataagcctggtgattctgcagaacctggcgaagaagta
accctgacgatcagtactggttatccggaggatgcggtcaattattcttacggtattccg
gtagccccggcacaggcggacaagaacagcaaaatccggattgtcttcaccgatgcgcgc
ggggagaatcaggactggggaaccaaaacgatcaacacggttcagaccttgtcggtcgat
ctggttctagcccctaacaaagacgccacggtcagtgtataccgggatggccagctgttc
gatacttaccgggtatcgtatattgacgccaagcagggaacggtaccaaccccggaactt
ccggtaaccgctcctcctgaatcaaacgatccgggacaaggggagtcgtatgttcccggt
gaatcggatgaggacggttcggggaatgatgttacgggtatgaacaataagggcaattat
gccggcaattctcttgcctctgttgacattaagcacggtcatgacaaaagtaaaaacaaa
gacggacggtaa

DBGET integrated database retrieval system