KEGG   Pseudomonas yamanorum: AK972_0114Help
Entry
AK972_0114        CDS       T05821                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
pym  Pseudomonas yamanorum
Brite
KEGG Orthology (KO) [BR:pym00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AK972_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE UPF0016
Motif
Other DBs
NCBI-ProteinID: AMW80914
UniProt: A0A143G9K2
LinkDB All DBs
Position
112979..113761
Genome map
AA seq 260 aa AA seqDB search
MEFLLYLLLGSCAGMLAGLFGVGGGIIIVPVLVFSFTLQGFDPSVLTHLAVGTSLASIIF
TSVNAVREHHRRGAVRWPIFVWMTVGILLGAGVGALTAEAISGPHLQKIIGVFALVIALQ
MTLELKPKASRQVPGKLGLTLAGGVIGWSSAIFGTGGGSLTVPFLTWRSVPMQQAVATSS
ACGLPIALASALSFMILGWHDPLLPEHSLGFVYLPALLGIALTSMVAARFGARLAHRLSP
RLLKRLFAGLLFCVGLNFLL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaatttctgctgtatttgctgctgggttcctgtgcgggcatgctcgccgggctgttc
ggcgtgggcggcgggatcattatcgtgcccgtgctggtgttcagcttcaccttgcagggc
ttcgatccctcggtgttgacccacctcgctgtcggcacatccctggcgtctattatcttc
acgtcggtgaatgcggtgcgtgagcatcaccggcgcggcgccgtgcgctggccgatcttt
gtgtggatgaccgtgggcatcctgctgggcgcaggcgttggcgcgctgaccgccgaagcg
atttccgggccgcacttgcagaagatcatcggagtgttcgccctggtgatcgccttgcag
atgaccctggagctcaagcccaaggccagccgtcaggtgccgggaaagctcggcctgacc
ttggcgggcggcgtgatcggctggtcgtcggcgattttcggcaccggcggcggttcgttg
accgtgccgttcctgacctggcgcagcgtgccgatgcagcaggcagtggccacctcgtcg
gcctgcggcttgccgatcgccctggccagtgcgttaagtttcatgattctgggctggcat
gatccgttgctgcccgagcatagtctcggctttgtgtatttgccggcgctgctgggcatt
gccctgaccagcatggtggcggcccgtttcggcgcgcgcctggcgcatcggttgtcgccg
cgcttgctcaagcggctgttcgccgggctgctgttttgcgtagggctgaattttttgctg
taa

DBGET integrated database retrieval system