KEGG   Pseudomonas yamanorum: AK972_0372Help
Entry
AK972_0372        CDS       T05821                                 

Definition
(GenBank) Anthranilate synthase, aminase component
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pym00405  Phenazine biosynthesis
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01130  Biosynthesis of antibiotics
pym01230  Biosynthesis of amino acids
pym02024  Quorum sensing
pym02025  Biofilm formation - Pseudomonas aeruginosa
Module
pym_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AK972_0372
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AK972_0372
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AK972_0372
   02025 Biofilm formation - Pseudomonas aeruginosa
    AK972_0372
Enzymes [BR:pym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AK972_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AMW81172
UniProt: A0A143GAA5
LinkDB All DBs
Position
391194..392675
Genome map
AA seq 493 aa AA seqDB search
MIREEFLRLAAAGYNRIPMACETLADFDTPLSIYLKLADEPNSYLLESVQGGEKWGRYSI
IGLPCRTVLRVHDHHVSITLDGVEIESHDVEDPLAFVEEFKARYNVPTIAGLPRFNGGLV
GYFGYDCVRYVEKRLGKSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLADPSQADA
FEQGQASLEALLEKLRQPITPRRGLDLSRPPAADPVFRSSFTQADYERAVDTIKEYILAG
DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNL
ITVRPIAGTRPRGATEEADLALEQDLLSDDKEIAEHLMLIDLGRNDTGRVSEIGSVKLTE
KMVIERYSNVMHIVSNVTGELKAGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR
GVYGGAVGYFAWNGNMDTAIAIRTAVIKDGELHVQAGGGIVADSVPALEWEETLNKRRAM
FRAVALAEQTPQD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgaagaattcctgcgtttggccgctgccggctacaaccgtatccccatggcc
tgcgaaaccctggccgacttcgacaccccgctgtcgatctacctgaagctggccgacgag
cctaactcctatctgctggagtcggtgcagggtggcgagaaatggggccgttattcgatc
atcggcctgccgtgccgcacagtgctgcgtgtccatgatcaccatgtgagcatcaccctg
gacggcgtcgagatcgaaagccacgacgtggaagacccgctggctttcgtcgaggaattc
aaggcgcgctacaacgtgccgaccatcgccggcctgccgcgcttcaacggcggcctggtg
ggttacttcggctacgactgcgtgcgctacgtggaaaaacgcctgggcaaatccccgaac
cccgatccgttgggcgtgccggacattctgctgatggtctccgatgcggtggtggtattc
gataacctcgcgggcaagatgcacgcgattgtgttggccgacccttcccaggcggacgcg
ttcgagcaaggccaggccagcctcgaagcgctgctggaaaagctgcgccagccgatcacc
ccgcgtcgcggcctggaccttagccgtccaccggcggctgacccggtgttccgctcaagc
ttcacccaggctgactacgagcgtgcggtcgataccatcaaggaatatatccttgccggt
gactgcatgcaggtggtgccgtcgcaacgcatgtccatcgacttcaaggctgcgccgatt
gatttgtaccgggcgctgcgctgcttcaacccgacgccgtacatgtacttcttcaacttt
ggcgacttccatgtggtaggcagttcgccggaagtgctggtgcgtgtggaagacaacctg
atcaccgtgcgcccgattgccggcacgcgccctcgcggtgcgaccgaggaggcggacctg
gcgctggagcaggacctgctgagcgacgacaaggaaatcgccgagcacttgatgctgatc
gacctgggccgcaacgacaccgggcgtgtttcggaaatcggttcggtgaagctcaccgag
aagatggtgatcgagcgttattccaacgtgatgcacatcgtgtccaacgtcaccggcgag
ctgaaggccggattgaccgcgatggatgcactgcgggcgatcctgccggcgggcaccttg
tcgggtgcgccgaagattcgtgcgatggaaatcatcgacgagctggagccggtcaagcgt
ggtgtgtatggcggcgcggtggggtatttcgcctggaacggcaatatggacactgcgatc
gcgatccgtacggcggtgatcaaggacggcgaactgcacgtgcaggcaggcggcgggatt
gtggccgactcggtgccggcgctggagtgggaagagacgctgaacaagcgccgggcgatg
ttccgtgcggtggcgttggctgagcagaccccgcaggactga

DBGET integrated database retrieval system