KEGG   Pseudomonas yamanorum: AK972_0946Help
Entry
AK972_0946        CDS       T05821                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00564  Glycerophospholipid metabolism
pym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AK972_0946
Enzymes [BR:pym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AK972_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2 Pyr_redox_2 GIDA Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AMW81746
UniProt: A0A143GD32
LinkDB All DBs
Position
complement(1027607..1029145)
Genome map
AA seq 512 aa AA seqDB search
MNPSTLPATPLAEVYDVAVIGGGINGVGIAADAAGRGLSVFLCEKDDLASHTSSASSKLI
HGGLRYLEHYEFRLVREALAEREVLLAKAPHIVKQMRFVLPHRPHLRPAWMIRAGLFLYD
HLGKREKLEGSKSLKFGPDSPLKSEITKGFEYSDCWVDDARLVVLNAMAAREKGAHIHTQ
TRCVSAHRSKGLWEMNMERADGSLFSIRARALVNAAGPWVAKFIKDDLKLDSPYGIRLIQ
GSHLIVPKLYEGAHAHILQNEDQRIVFTIPYLNHLTIIGTTDREYTGDPAKVAITEGETD
YMLNVVNAHFKKQLSRDDIVHTYSGVRPLCNDESDNPSAVTRDYTLALSGTSGEAPLLSV
FGGKLTTYRKLAESAMAQLAPYFTQMRPSWTAAATLPGGENMSTPEALADAIRSKYDWVP
SEIARRWSTTYGSRTWRLLEGVQSLADMGDHLGGGLYTREVDYLCAEEWATQPQDILWRR
SKLGLFTTPEEQENVQRYLSKVEHNRGKIEAA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttctaccttgcctgccacaccgcttgccgaagtctatgacgtcgccgttatc
ggtggcgggatcaatggcgtcggcattgcagcagacgcagccggtcgcggtttgtcggta
ttcctttgcgaaaaggacgacctggccagccacacctcctccgccagcagcaagctgatc
cacggtggcctgcgttatttggagcattacgaattccgcctggtgcgcgaagccctggct
gaacgtgaggtgctgttggccaaggccccgcacatcgtcaagcagatgcgctttgtattg
ccacaccgcccgcacctgcgcccagcgtggatgattcgcgccggcctcttcctgtatgac
cacctgggcaagcgggaaaaactcgaaggttccaagagcctcaagttcggtcccgacagc
ccgctgaaaagcgaaatcaccaaaggcttcgaatactccgattgctgggtcgacgacgcc
cgcctcgtagtactcaacgccatggccgcgcgggaaaagggtgcgcatatccacacccag
acccgttgcgtcagcgcgcaccgcagcaaaggcctgtgggaaatgaacatggaacgcgcc
gacggcagcctgttctcgatccgcgcccgggcactggtgaacgcagccggcccatgggtc
gccaagttcatcaaggatgacttgaagctggattcgccttacggcatccgcctgatccag
ggcagccacctgatcgtgccgaagctgtatgaaggcgcccacgcgcacatcctgcagaac
gaagaccagcgcatcgtcttcaccattccgtacctgaatcacctgaccatcatcggcacc
accgaccgcgaatacaccggcgacccggcgaaagtggcgattaccgaaggtgagaccgac
tacatgctcaatgtggtcaatgcgcatttcaagaagcagctgagccgcgatgacatcgtg
cacacctattccggcgtgcgcccgctgtgcaacgacgaatccgacaacccgtcggccgtg
acccgcgactacaccctggcgctgtcgggcacctcgggcgaggcgccactgctgtcggtg
ttcggcggcaagctgaccacctaccgcaagctggctgagtcggcgatggcgcagttggca
ccgtacttcacgcagatgcgcccaagctggacggctgcggccaccctgcccggcggcgaa
aacatgagcacgccagaagccctggccgatgcgattcgcagcaagtacgactgggtgcca
agcgagattgcccgccgttggtccaccacttacggcagccgcacctggcgtctgctggaa
ggcgtgcagtcgctggcagacatgggcgaccacctcggtggcggcctgtacacccgcgaa
gtcgactacctgtgcgctgaagaatgggccacgcagccccaggacatcctgtggcgccgc
agcaagctgggcctgttcaccacgccggaagaacaggaaaacgtacaacgctacctgtcc
aaggttgagcacaatcgcggcaaaatcgaagccgcttga

DBGET integrated database retrieval system