KEGG   Pseudomonas yamanorum: AK972_2705Help
Entry
AK972_2705        CDS       T05821                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pym  Pseudomonas yamanorum
Pathway
pym03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pym00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AK972_2705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pym03400]
    AK972_2705
Enzymes [BR:pym01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AK972_2705
DNA repair and recombination proteins [BR:pym03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AK972_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AMW83505
UniProt: A0A143GGU4
LinkDB All DBs
Position
complement(3013425..3015923)
Genome map
AA seq 832 aa AA seqDB search
MAKPLSEYNAKRDFDVTAEPAGSAPRGRSRAQALTFVIQKHDARNLHYDFRLELDGVLKS
WAVPKGPSLDPSQKRLAVHVEDHPLGYGSFEGSIPAGQYGAGDVIVWDRGVWQPHDDPRK
AYAAGKLKFTLIGEKLAGDWTLVRTRLKGSGDKEQWLLIKENDQQARPVADYDVVQAEPK
SVLSDAMVGRPKKPAAAKKPTRKSSTALPDQLTPQLATLVDRAPEGDWVYEIKFDGYRIL
TRIRDGEVRLFTRNGHDWTDRLPRQVKALEALKLKDSWLDGEVVSLNADGLPDFQALQNA
FDIGRSLDIVYYLFDAPFLEGRDQREVAVEERRAALKSVLTRSRSKLLRFSESFAANQRD
IFESACDLALEGVIGKRAGSLYVSKRSPDWIKLKCRLRQEFIIVGFTRPQGSRSGFGALL
LAVNDDTGLVYAGRVGTGFDQAALKKISEQLKALERDASPLAKPLTSAQARGVHWVEPQL
VSEVQFAEWTREGVVRQAAFVGLRTDKPAEQIVHEQPRAAKSMKEKTRKKATEPGAVVGV
KITHPDRVIDTQSGTQKLQLAQFYEGISEWILPFLRNRPVSLLRAPEGIAGEQFFQKHSE
HLAIPNIKQLDQALDPGHARLMEIDSPAALIGAVQMGTVELHTWGATADKIETPDLFVLD
LDPDPALPWKSMLEAAQLTLSVLDELGLEAFVKTSGGKGLHLVIPLARKDDWDTVKAFAK
AIAQFMTQQLPERFTATSGPKNRIGKIFIDYLRNARGASTVAAYSVRARPGLPVSVPVSR
DELKGLHGAQQWTVANLHERLQNLKKDPWAGYANRQKISKKMWEKLGAHPPG
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccctgagtgaatacaacgccaagcgcgacttcgatgtaaccgccgaacct
gcaggcagtgcgcctcgcggcaggagccgggcccaggccttgaccttcgtgattcaaaag
cacgatgcgcgcaacctgcattacgactttcgcctggaactcgatggcgtgctcaaaagc
tgggcggtgcccaagggcccgagcctggacccgagccagaagcgcctcgccgtgcacgtg
gaagatcatccattgggctacggcagtttcgagggcagcattcccgccggccagtacggc
gcgggtgacgtgatcgtctgggaccgcggcgtgtggcagccccacgacgacccgcgcaaa
gcctacgcggcgggcaagctgaaattcaccctgatcggcgaaaagctcgccggcgactgg
acattggtgcgcacgcggctcaagggcagcggcgataaggagcagtggctgttgatcaag
gagaacgatcagcaggcgcgcccggtggctgactacgacgtggtccaggccgagccgaaa
agcgtgttgagcgatgcaatggtggggcgcccgaaaaaaccagctgctgcgaagaaaccc
acgcgcaaatcctcaactgccctgcccgatcagctcaccccacaattggcgacgctggtg
gaccgtgcaccggagggcgactgggtgtacgagatcaaattcgacggctaccgcatcctc
acgcgtattcgtgacggcgaggtacggctgttcactcgcaatggtcatgactggactgat
cggctgccgcgccaggtcaaggccctggaggcgcttaagctcaaggacagttggctcgac
ggcgaggtggtcagcctgaacgcggatgggttaccggacttccaggcattgcaaaatgcc
tttgatatcggtcgcagcctggacattgtctattacctgtttgatgcgccgtttctggaa
ggtcgtgaccagcgcgaggtcgccgtcgaagagcggcgcgccgcgctgaaaagcgtgctg
acccgcagcaggagcaagctgctgcgcttctccgagtccttcgccgccaatcagcgggat
atcttcgaaagcgcctgtgacctggcgctggagggcgtgatcggaaaacgtgcgggcagc
ctgtacgtctccaagcgcagccccgactggatcaagctcaagtgccggctgcgacaggaa
ttcataatcgtcggtttcacccgtccgcaaggttcacgcagtggctttggcgcactgctg
ctggcggtcaatgacgacaccgggctggtgtatgccgggcgcgtgggtacggggtttgat
caggcggccttaaagaagatcagtgagcagttgaaagccttggagcgcgatgcgtcacca
ctggccaaaccgctgaccagcgcccaggcgcgtggtgtgcactgggtcgaaccgcagttg
gtaagcgaagtgcaattcgccgaatggactcgcgaaggtgtggtgcgccaggcggccttt
gtcgggctgcgtaccgacaagccggcggagcagattgttcatgagcagccgcgggcggcc
aagtcgatgaaggaaaaaacccgtaaaaaggcaactgagcccggtgctgtggtcggggtc
aagatcacccatcccgaccgagtcatcgacacccaaagcggtacacagaaactacaactg
gcgcagttctacgagggcatcagcgaatggatcctgcccttcttgcgtaaccgtcctgtg
tctttgctcagggcaccggaaggcattgcgggtgaacagttttttcagaagcactccgaa
cacctggcgatcccgaatatcaagcaactggatcaggctctggatccgggtcatgcacgg
ctgatggaaatcgacagccccgccgcgctgatcggtgcggtgcaaatgggcaccgtcgag
ttgcacacttggggcgccaccgcggacaaaatcgaaaccccggacctgtttgtgctcgac
cttgacccggacccggccctgccatggaaaagcatgcttgaagcggcgcaactaactctg
tcggtgctggatgagctggggcttgaagcgttcgtcaagaccagcggtggcaagggcctg
cacctggtgataccgctggcgcgcaaggatgactgggatacggtaaaggccttcgccaag
gcgattgcccagttcatgacgcagcagttgccggagcgttttaccgcgacctcaggcccg
aaaaatcgcatcggcaagatctttatcgattacctgcgaaacgcccggggcgccagtacg
gtggcggcctactcggtgcgcgcgcggcccggcctgccggtgtcggtgccggtgagtcgt
gacgagttgaagggtttgcacggcgcccagcaatggaccgtggccaacctgcacgagcga
ttgcagaatttgaagaaggatccgtgggcgggttatgccaatcggcagaagatcagcaag
aagatgtgggagaagctgggcgcgcatccgccaggctga

DBGET integrated database retrieval system