KEGG   Pseudomonas yamanorum: AK972_3023Help
Entry
AK972_3023        CDS       T05821                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pym  Pseudomonas yamanorum
Brite
KEGG Orthology (KO) [BR:pym00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AK972_3023
Enzymes [BR:pym01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AK972_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase FMO-like Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMW83823
UniProt: A0A143GHM9
LinkDB All DBs
Position
complement(3392585..3394138)
Genome map
AA seq 517 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLSTLITLKSDGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDDRQIMAVPSVYLNGVSF
GQGRMGLEEILAKLDTSGIEKQAEKISAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLASALEEHVKQYDVDIMNLQRANALIPAKNAGE
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgttgcctccctcgacgacggtgcgaaatcccaggaaatgcttgccctcttg
caggatgtagccagcctctcaacgctgattaccctgaaaagcgatggcgatgatgcgcgc
aagccgtcgttctccatcaaccgcccgggtgccgatatcagcctgcgtttcgccggcatc
ccaatgggccatgaattcacttcgctggtgttggcgctgctgcaagtcggcggccacccc
tcgaaggccagtgtcgaagtgattgaacagattcgtgcccttaaaggcgagttcagcttc
gaaacttacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcagtactgaacccgaacatccgccacgtcgccatcgacggtgcgctgttccaggcc
gaagtcgatgatcgtcagatcatggctgtgccgagcgtttacctgaacggtgttagcttc
ggccagggccgcatgggcctggaagagatcctcgccaagctcgacaccagcggcattgaa
aaacaagccgagaaaatcagcgccaaagaggcctttgacgtactggtcgttggcggtggc
ccagccggtgccgctgcggcgatctacgcggcccgtaaaggcattcgtaccggtgtggcc
gctgagcgttttggtggccaggtgctggataccatggcgatcgagaactttatctcggtg
caggaaaccgaagggccgaaactggccagtgcccttgaagaacacgtcaaacagtacgac
gtggacatcatgaacctgcaacgcgccaacgcgctgatcccggccaagaacgcgggtgag
ctgcacgaaatccgtttcgaaagcggtgcgaccctcaagtccaagaccgtgatcctggcc
accggcgcccgctggcgtgaaatgggcgtgccgggcgagcaggaatacaaggccaagggc
gtgtgcttttgcccgcattgcgatggtccactgttcaaaggcaagcgtgtggcggtgatc
ggcggcggtaactccggcgttgaggcggccatcgacctggccggtattgtcagccacgtg
accttgctggaattcgacagcaaactgcgcgccgatgcggtattgcaacgtaagttgtac
agcctgcccaacgttgacgtgatcaccagtgcgctcaccagcgaagtcaaaggcgatggc
cagaaggtcaccggcctggcgtacaaggaccgtgacagcggcgagttcaagaccgtcgac
ctggaagggatctttgtccagatcggtttgctgcccaacaccgactggctcaagggtacc
gtcgagctgtcgccccgtggcgagatcattgtcgatgcccggggtgagacctcattgcca
ggcgtctttgctgccggcgacgtcaccaccgtgccgtataagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttccctgagtgctttcgatcacctgatccgcagctaa

DBGET integrated database retrieval system