KEGG   Pseudomonas yamanorum: AK972_4169Help
Entry
AK972_4169        CDS       T05821                                 

Definition
(GenBank) Chorismate mutase I
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01130  Biosynthesis of antibiotics
pym01230  Biosynthesis of amino acids
Module
pym_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AK972_4169
Enzymes [BR:pym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     AK972_4169
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     AK972_4169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HNHc_6
Motif
Other DBs
NCBI-ProteinID: AMW84969
UniProt: A0A1H2F4S6
LinkDB All DBs
Position
complement(4604640..4605734)
Genome map
AA seq 364 aa AA seqDB search
MSEQELKALRVRIDSLDEKVLELISERARCAQEVARVKMASLAEGEVPVFYRPEREAQVL
KRVMERNKGPLGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVIS
KPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLL
VGENTKTDSISRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAG
DMAAGLYGLTRLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSNKPGALHELLV
PFHDNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP
KAVL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaagaactcaaggccctgcgcgtacgcattgatagcctggacgagaaagtc
ctggagctgatcagtgagcgcgcgcggtgcgcccaggaagttgcacgggtgaaaatggcg
tccctggctgaaggcgaagtgccggtgttctaccggccggagcgtgaagcccaggtgctc
aagcgcgtgatggagcgcaacaagggcccgttgggcaacgaagagatggcgcggttgttc
cgtgaaatcatgtcttcgtgcctggcgctggaacagccgctgaaagtggcttacctgggc
cctgaaggcaccttcacccaagccgcggccatgaagcatttcggccacgcggtgatcagc
aagccgatggcagcgatcgatgaagtgttccgtgaagtggcagccggtgcggtgaatttt
ggcgtggtgccggtggaaaactccaccgaaggtgccgtcaaccacaccctcgacagcttc
cttgagcacgacatggtgatctgcggcgaagttgagctgcgtatccatcatcacctgttg
gtgggcgaaaacaccaagaccgacagcatcagccgcatctactcccacgcccagtcccta
gcccagtgccgcaagtggctggacgcgcactacccgaatgtggaacgcgtggcggtgtcc
agcaacgccgaagcggcgaagcgggtcaagggtgagtggaattcggcggcaattgcgggc
gacatggccgctggcctgtatggcctgacgcgcctggctgagaaaatcgaggaccgcccg
gataactccacgcgcttcctgatgatcggcagccaggaagtgccgccgaccggcgacgac
aagacgtcgatcatcgtttccatgagcaacaagcctggcgcgctgcatgagctgctggtg
ccgttccacgacaacgggattgacctgacgcgaatcgagacgcgtccttcgcgcagcggt
aaatggacttatgtgttctttatcgacttcgtcggccatcaccgcgacccactggtcaag
ggtgtgctcgagaaaatcagtcaggaagccgtggcactcaaggtgctgggctcttacccg
aaagcggttttgtga

DBGET integrated database retrieval system