KEGG   Pseudomonas yamanorum: AK972_5504Help
Entry
AK972_5504        CDS       T05821                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01130  Biosynthesis of antibiotics
pym01230  Biosynthesis of amino acids
Module
pym_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AK972_5504
Enzymes [BR:pym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     AK972_5504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AMW86304
UniProt: A0A145X888
LinkDB All DBs
Position
complement(6116749..6117849)
Genome map
AA seq 366 aa AA seqDB search
MQTLKVDLGERSYPIHIGEGLLDQPELLAPHIAGRQVAIISNETVAPLYLERLSRSLAAY
SVISVVLPDGEAFKTWETLQLIFDGLLTARHDRRTTVVALGGGVIGDMAGFAAACYQRGV
DFIQVPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPNVVLIDTATLNTLPPRELSAGL
AEVIKYGLICDEPFLTWLEEHVDALRALDQVALTEAISRSCAAKALVVNADERESGVRAT
LNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSQRLGWISAQERDRGIRLFQRAGL
PVIPPEEMTEADFLEHMAIDKKVIDGRLRLVLLRRMGEAVVTDDYPKEILQATLGADYRA
LAQLKG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacttaaggtcgatcttggcgagcgcagctacccgatccatattggcgaaggt
ttgttggaccagcccgagctgctcgcaccgcatattgccgggcggcaagtggcgatcatc
tccaatgaaacggtcgcgccgctgtatcttgagcgtctgagccgaagccttgcggcgtat
tcggtgatctcggtggtattgcccgacggtgaggccttcaagacttgggaaaccctgcaa
ctgatctttgatggcctgctgacggcccgtcatgaccgtcgcaccaccgtagtggcgctg
ggcggcggcgtgatcggcgatatggccggctttgcggccgcctgctaccagcgcggcgtg
gactttatccaggtgccgaccacgttgctgtcccaggtcgattcgtcggtgggcggcaag
accggtatcaaccatccgctgggcaagaacatggtcggtgcgttctatcagccgaatgtc
gtgctgatcgacaccgccaccctcaataccctgccgccccgcgagctgtcggcaggcttg
gcggaagtcatcaagtacggcctgatctgcgacgagcctttcctgacctggcttgaagag
catgtcgacgccctgcgcgccctcgaccaggtggcgctgaccgaagcaatttcccgctcc
tgcgctgccaaggcgttggtggtaaatgccgacgagcgtgagtccggtgtgcgcgccacg
ttgaacctcggccacaccttcggccatgcgatcgagactcacatgggctatggtgtgtgg
ttgcatggagaggccgtagcggctggcacggtgatggcattggagatgtcgcaacgcctg
ggctggatcagtgcccaagagcgtgatcgcgggatccgcctgttccagcgcgccgggttg
ccggtcattcctcctgaagagatgactgaggcagattttctcgaacatatggcaatagac
aagaaagtgatcgacggtcgactgcgactggtgctgttgcgccgaatgggcgaagcggta
gtgaccgacgattatccgaaagagattttacaggccacgctgggagcggattaccgcgcc
ctggcccagcttaaaggttaa

DBGET integrated database retrieval system