KEGG   Pyrococcus sp. NA2: PNA2_0537Help
Entry
PNA2_0537         CDS       T01487                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pyn  Pyrococcus sp. NA2
Pathway
pyn00620  Pyruvate metabolism
pyn00680  Methane metabolism
pyn00720  Carbon fixation pathways in prokaryotes
pyn01100  Metabolic pathways
pyn01120  Microbial metabolism in diverse environments
pyn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PNA2_0537
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PNA2_0537
   00680 Methane metabolism
    PNA2_0537
Enzymes [BR:pyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PNA2_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 DUF1825
Motif
Other DBs
NCBI-ProteinID: AEC51453
UniProt: F4HKU8
LinkDB All DBs
Position
complement(456541..457953)
Genome map
AA seq 470 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFASSPVLGGDDEITEAFYAFSVLGADEQMWDFEGKEVDEFVV
KKLLERYSMFFKKVILGKDVRITPRVPNPSVEKAEAKLLIETLQGITRAADYAKVFYEDD
IAPIFEVILPMTTSLAEIERVYMLYKRIVELANEVIYDVTVREWIGDFYPKEIGVIPLFE
TKVALLKSAKIVKDYISRRRNIEYMRVFFARSDPAMNYGLISAVTYVKKALYEMFKVEDS
LSIPIYPIIGVGGPPFRGGMRPDNVENVVREYPSVQTYTIQSSFKYDHPTKEVVKAVEFV
KSTKRREPHFVDIPDFIQLYEVEYQRQIKILAPHIRRVVTRIPDRRRRKLHIGLFGYSRR
IGDMALPRAIKFTASLYSIGIPPELLALNALSDKQLDIVSEYYKNVYEDLEFAMRFFSFK
VAESVGLKELVERIKEFKPEINEEYVSEAEQVFRGQGDVIKLAQIRGFLG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaggataatgagcactcaacatcctgataattattcaatccccttctttgcg
agctctcccgttcttggtggtgatgatgagataactgaagcattctacgccttcagcgtt
ttaggagcagacgagcagatgtgggattttgaaggaaaggaggttgacgagtttgtcgta
aagaaattgcttgagagatactcgatgttcttcaagaaggtaatcctgggaaaggatgta
aggataaccccaagagtcccaaacccgagcgttgagaaggctgaggcaaaacttttgatt
gaaactctgcagggcataacgcgggccgcggattacgcgaaggtattctatgaggatgac
atagctccgatatttgaggttatacttccaatgacgacaagcttagctgaaatagagagg
gtctacatgctttacaagagaattgttgagcttgcaaatgaggtaatctatgatgtcacc
gttagggaatggataggagacttctatccgaaggagattggagttatacctttgttcgag
acaaaggtcgctcttctcaaatctgcaaagatcgtgaaggattatatctcaaggagaagg
aatattgagtacatgcgagttttcttcgcaaggagtgatccagcgatgaactatggttta
atatcagctgtgacctatgtaaagaaggccctctatgaaatgttcaaagtcgaggacagc
ctgtcgattccaatatatccaataataggcgttggagggcctccttttagaggtggaatg
agacctgacaatgttgagaacgttgttagggagtacccaagtgttcaaacgtacacaatt
caaagtagctttaagtatgaccatccaacaaaggaggtagtcaaggcagttgaattcgtt
aagtcaaccaagaggagagaacctcatttcgtggatattccagactttatacagctgtat
gaggtcgagtaccagagacagataaagatcttggctccccatataaggagggtcgtaacg
agaattccagataggaggagaagaaagctccatataggactttttggatattcaaggaga
attggggatatggcactcccaagggcaataaagttcactgcttctctgtattcgattggt
attcccccagaactcttggccttaaacgcgctaagtgataaacagcttgacatagtttcc
gagtattacaagaacgtgtatgaggatttggagtttgccatgaggtttttcagcttcaag
gttgcggagagcgttgggcttaaggaattagttgaaaggattaaggaatttaagccggaa
atcaatgaagaatacgtaagtgaagctgagcaggttttcaggggtcagggtgatgttatt
aaacttgcacagattagaggcttcctgggatga

DBGET integrated database retrieval system