KEGG   Pyrococcus sp. NA2: PNA2_1272Help
Entry
PNA2_1272         CDS       T01487                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pyn  Pyrococcus sp. NA2
Pathway
pyn00260  Glycine, serine and threonine metabolism
pyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PNA2_1272
Enzymes [BR:pyn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     PNA2_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AEC52187
UniProt: F4HNP3
LinkDB All DBs
Position
1173594..1174643
Genome map
AA seq 349 aa AA seqDB search
MSERMIAIMKTKPAYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEVGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVD
TDGVFAEYAVVPAQNVWKNPKSIPPEYATLQEPLGNAVDTVLAGPISGKSVLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVF
LEFSGAPKALEQGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKALTVYGITGRHLWETW
YTVSRLLQSGKLNIDPIITHKYKGFDKYEEAFELMRAGKTGKVVFMLKD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaggatgatagctatcatgaagacgaaaccagcctatggtgcagagcttgtt
gaagtggatgttccaaagcctggtcccggtgaagttttaataaaggttctagcaaccagc
atatgtgggactgacctacacatatacgagtggaacgaatgggcccaatcaagaataaag
ccaccacagatcatgggtcatgaggttgcaggtgaagttgttgaagttggtccaggggtc
gaagggatagaagttggcgactacgtaagcgtcgagacgcacatagtttgtggaaaatgc
tacgcatgtagaaggggacagtaccacgtttgtcagaatacgaagatattcggcgtagat
acagatggagttttcgctgagtatgctgtggttcctgcccaaaacgtttggaagaatcca
aagtcgattcctccagaatatgcaacccttcaagagccccttggaaatgctgttgatacg
gttttggcgggcccaatatctggtaaaagcgttctaataacaggagctggcccattggga
ttgctaggaatagctgttgcaaaggcatctggtgcctatcctgttatagtttctgaaccc
agtgagtttagaaggaatcttgcgaaaaaggttggtgctgattatgtaataaatccattt
gaggaggatgtagtcaaagaggtaatggacataactgatgggaatggcgtcgatgttttt
ttggagttcagcggagcaccaaaggctctagagcaggggcttcaagctgtaaccccggca
ggtagagtatctcttttaggcctattcccaggaaaagttagcattgacttcaacaatctt
ataatattcaaggccttgacggtctatggaataactgggagacatttatgggaaacttgg
tacacggtttcaagactccttcagagtgggaaacttaacatagacccaataataacacac
aagtacaagggatttgataagtatgaggaggcctttgaacttatgagggctggcaaaact
ggcaaggttgtttttatgcttaaagattag

DBGET integrated database retrieval system